DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chao-2005-5 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chao JA., Lee JH., Chapados BR., Debler EW., Schneemann A., Williamson JR. DIP original experiment: DIP-254806X Nature structural & molecular biology 2005 IMEx Dual modes of RNA-silencing suppression by Flock House virus protein B2. Chao JA., Lee JH., Chapados BR., Debler EW., Schneemann A., Williamson JR. Only protein-protein interactions imex curation b2_fhv Protein B2 B2 protein protein fhv Flock house virus FHV MPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSLLEKPSVVAYLEGKAPEEAKPTLEERLRKLELSHSLPTTGSDPPPAKL b2-1 3139143 N/A 3139144 unspecified role unspecified role unspecified role unspecified role Region 1-73 Region 1-73 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false