DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ballut-2005-1 ecolx Escherichia coli tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Ballut L., Marchadier B., Baguet A., Tomasetto C., Séraphin B., Le Hir H. DIP original experiment: DIP-255135X Nature structural & molecular biology 2005 IMEx The exon junction core complex is locked onto RNA by inhibition of eIF4AIII ATPase activity. Ballut L., Marchadier B., Baguet A., Tomasetto C., Séraphin B., Le Hir H. Only protein-protein interactions imex curation ballut-2005-2 in vitro In vitro tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Ballut L., Marchadier B., Baguet A., Tomasetto C., Séraphin B., Le Hir H. DIP original experiment: DIP-255138X Nature structural & molecular biology 2005 IMEx The exon junction core complex is locked onto RNA by inhibition of eIF4AIII ATPase activity. Ballut L., Marchadier B., Baguet A., Tomasetto C., Séraphin B., Le Hir H. Only protein-protein interactions imex curation ballut-2005-3 in vitro In vitro tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Ballut L., Marchadier B., Baguet A., Tomasetto C., Séraphin B., Le Hir H. DIP original experiment: DIP-255139X Nature structural & molecular biology 2005 IMEx The exon junction core complex is locked onto RNA by inhibition of eIF4AIII ATPase activity. Ballut L., Marchadier B., Baguet A., Tomasetto C., Séraphin B., Le Hir H. Only protein-protein interactions imex curation ballut-2005-4 in vitro In vitro tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Ballut L., Marchadier B., Baguet A., Tomasetto C., Séraphin B., Le Hir H. DIP original experiment: DIP-255137X Nature structural & molecular biology 2005 IMEx The exon junction core complex is locked onto RNA by inhibition of eIF4AIII ATPase activity. Ballut L., Marchadier B., Baguet A., Tomasetto C., Séraphin B., Le Hir H. Only protein-protein interactions imex curation ballut-2005-5 in vitro In vitro tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Ballut L., Marchadier B., Baguet A., Tomasetto C., Séraphin B., Le Hir H. DIP original experiment: DIP-255136X Nature structural & molecular biology 2005 IMEx The exon junction core complex is locked onto RNA by inhibition of eIF4AIII ATPase activity. Ballut L., Marchadier B., Baguet A., Tomasetto C., Séraphin B., Le Hir H. Only protein-protein interactions imex curation q9y5s9-1 RNA-binding protein 8A RBM8A Binder of OVCA1-1 RBM8 RNA-binding motif protein 8A RNA-binding protein Y14 Ribonucleoprotein RBM8A HSPC114 MDS014 BOV-1a protein protein human Homo sapiens Human MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR mgn_human Protein mago nashi homolog MAGOH MAGOHA protein protein human Homo sapiens Human MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI casc3_human Protein CASC3 CASC3 MLN51 Cancer susceptibility candidate gene 3 protein Metastatic lymph node gene 51 protein Protein barentsz protein protein human Homo sapiens Human MADRRRQRASQDTEDEESGASGSDSGGSPLRGGGSCSGSAGGGGSGSLPSQRGGRTGALHLRRVESGGAKSAEESECESEDGIEGDAVLSDYESAEDSEGEEGEYSEEENSKVELKSEANDAVNSSTKEEKGEEKPDTKSTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQELIALYGYDIRSAHNPDDIKPRRIRKPRYGSPPQRDPNWNGERLNKSHRHQGLGGTLPPRTFINRNAAGTGRMSAPRNYSRSGGFKEGRAGFRPVEAGGQHGGRSGETVKHEISYRSRRLEQTSVRDPSPEADAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKLAEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLNIAEQNWSPGQPSFLQPRELRGMPNHIHMGAGPPPQFNRMEEMGVQGGRAKRYSSQRQRPVPEPPAPPVHISIMEGHYYDPLQFQGPIYTHGDSPAPLPPQGMLVQPGMNLPHPGLHPHQTPAPLPNPGLYPPPVSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPNTQAPSQVYGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSRGSS if4a3_human Eukaryotic initiation factor 4A-III KIAA0111 EIF4A3 DDX48 Eukaryotic translation initiation factor 4A isoform 3 ATP-dependent RNA helicase eIF4A-3 ATP-dependent RNA helicase DDX48 DEAD box protein 48 Eukaryotic initiation factor 4A-like NUK-34 Nuclear matrix protein 265 protein protein human Homo sapiens Human MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI magoh-rbm8a-19 3138890 N/A 3138895 unspecified role unspecified role prey prey Region 50-174 Region 50-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3138896 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false casc3-eif4a3-1 3138891 N/A 3138895 unspecified role unspecified role prey prey Region 50-174 Region 50-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3138897 unspecified role unspecified role bait bait Region 137-283 Region 137-283 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false O15234:p.Trp218Ala W94A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O15234:p.His220_Asp221delinsAlaAla H51A/D52A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O15234:p.Tyr240_Gly241delinsAlaAla Y71A/G72A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3138898 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3138896 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false casc3-eif4a3-2 3138892 N/A 3138897 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region Region 137-283 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O15234:p.Trp218Ala W94A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O15234:p.His220_Asp221delinsAlaAla H51A/D52A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O15234:p.Tyr240_Gly241delinsAlaAla Y71A/G72A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3138898 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false magoh-eif4a3-1 3138893 N/A 3138895 unspecified role unspecified role prey prey Region 50-174 Region 50-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3138898 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3138896 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false magoh-casc3-2 3138894 N/A 3138895 unspecified role unspecified role prey prey Region 50-174 Region 50-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3138897 unspecified role unspecified role prey prey Region 137-283 Region 137-283 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3138898 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3138896 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false