DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ barton-2005-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Barton WA., Tzvetkova D., Nikolov DB. DIP original experiment: DIP-132772X Structure (London, England : 1993) 2005 IMEx Structure of the angiopoietin-2 receptor binding domain and identification of surfaces involved in Tie2 recognition. Barton WA., Tzvetkova D., Nikolov DB. Only protein-protein interactions imex curation barton-2005-2 in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Barton WA., Tzvetkova D., Nikolov DB. DIP original experiment: DIP-132774X Structure (London, England : 1993) 2005 IMEx Structure of the angiopoietin-2 receptor binding domain and identification of surfaces involved in Tie2 recognition. Barton WA., Tzvetkova D., Nikolov DB. Only protein-protein interactions imex curation barton-2005-3 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Barton WA., Tzvetkova D., Nikolov DB. DIP original experiment: DIP-132773X Structure (London, England : 1993) 2005 IMEx Structure of the angiopoietin-2 receptor binding domain and identification of surfaces involved in Tie2 recognition. Barton WA., Tzvetkova D., Nikolov DB. Only protein-protein interactions imex curation tie2_human Angiopoietin-1 receptor TEK TIE2 Tyrosine-protein kinase receptor TIE-2 Tyrosine-protein kinase receptor TEK Tunica interna endothelial cell kinase p140 TEK Endothelial tyrosine kinase Tyrosine kinase with Ig and EGF homology domains-2 VMCM VMCM1 protein protein human Homo sapiens Human MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSVLLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA o15123-1 Angiopoietin-2 ANGPT2 protein protein human Homo sapiens Human MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF angpt2-tek-1 3137828 N/A 3137831 unspecified role unspecified role unspecified role unspecified role Ligand binding domain Region 1-448 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3137832 unspecified role unspecified role unspecified role unspecified role Receptor binding domain Region 276-496 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false O15123-1:p.[Phe469Ala;Tyr475Ala;Tyr476Ala] F469A/Y475A/Y476A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false O15123-1:p.[Lys468Glu;Lys473Glu] K468E/K473E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false angpt2-tek-2 3137829 N/A 3137831 unspecified role unspecified role unspecified role unspecified role Ligand binding domain Region 1-448 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3137832 unspecified role unspecified role unspecified role unspecified role Receptor binding domain Region 276-496 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false angpt2-tek-3 3137830 N/A 3137831 unspecified role unspecified role unspecified role unspecified role Ligand binding domain Region 1-448 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3137832 unspecified role unspecified role unspecified role unspecified role Receptor binding domain Region 276-496 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false