DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lopper-2004-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lopper M., Holton JM., Keck JL. DIP original experiment: DIP-132898X Structure (London, England : 1993) 2004 IMEx Crystal structure of PriB, a component of the Escherichia coli replication restart primosome. Lopper M., Holton JM., Keck JL. Only protein-protein interactions imex curation lopper-2004-2 ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Lopper M., Holton JM., Keck JL. DIP original experiment: DIP-132899X Structure (London, England : 1993) 2004 IMEx Crystal structure of PriB, a component of the Escherichia coli replication restart primosome. Lopper M., Holton JM., Keck JL. Only protein-protein interactions imex curation lopper-2004-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lopper M., Holton JM., Keck JL. DIP original experiment: DIP-132900X Structure (London, England : 1993) 2004 IMEx Crystal structure of PriB, a component of the Escherichia coli replication restart primosome. Lopper M., Holton JM., Keck JL. Only protein-protein interactions imex curation prib_ecoli Primosomal replication protein N priB b4201 JW4159 protein protein ecoli Escherichia coli (strain K12) MTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD prib-1 3137375 N/A 3137378 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prib-2 3137376 N/A 3137378 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prib-3 3137377 N/A 3137378 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false