DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ shendelman-2004-1 in vitro In vitro comigration in sds comigration in sds page comigration in sds western blot western blot Immuno blot Immuno blot Shendelman S., Jonason A., Martinat C., Leete T., Abeliovich A. DIP original experiment: DIP-132410X PLoS biology 2004 IMEx DJ-1 is a redox-dependent molecular chaperone that inhibits alpha-synuclein aggregate formation. Shendelman S., Jonason A., Martinat C., Leete T., Abeliovich A. Only protein-protein interactions imex curation imex curation shendelman-2004-2 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Shendelman S., Jonason A., Martinat C., Leete T., Abeliovich A. DIP original experiment: DIP-132411X PLoS biology 2004 IMEx DJ-1 is a redox-dependent molecular chaperone that inhibits alpha-synuclein aggregate formation. Shendelman S., Jonason A., Martinat C., Leete T., Abeliovich A. Only protein-protein interactions imex curation imex curation shendelman-2004-3 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Shendelman S., Jonason A., Martinat C., Leete T., Abeliovich A. DIP original experiment: DIP-132412X PLoS biology 2004 IMEx DJ-1 is a redox-dependent molecular chaperone that inhibits alpha-synuclein aggregate formation. Shendelman S., Jonason A., Martinat C., Leete T., Abeliovich A. Only protein-protein interactions imex curation imex curation syua_human Alpha-synuclein Non-A beta component of AD amyloid Non-A4 component of amyloid precursor SNCA NACP PARK1 protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA park7_human Parkinson disease protein 7 PARK7 Oncogene DJ1 Parkinsonism-associated deglycase Maillard deglycase Protein DJ-1 Protein/nucleic acid deglycase DJ-1 protein protein human Homo sapiens Human MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD snca-21 3137332 N/A 3137335 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false snca-park7-1 3137333 N/A 3137335 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse N/A 3137336 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false park7-park7-1 3137334 N/A 3137336 unspecified role unspecified role prey prey YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse N/A 3137336 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q99497:p.Leu166Pro L166P mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse physical association physical association false false false