DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ schnatwinkel-2004-1 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Schnatwinkel C., Christoforidis S., Lindsay MR., Uttenweiler-Joseph S., Wilm M., Parton RG., Zerial M. DIP original experiment: DIP-110922X PLoS biology 2004 IMEx The Rab5 effector Rabankyrin-5 regulates and coordinates different endocytic mechanisms. Schnatwinkel C., Christoforidis S., Lindsay MR., Uttenweiler-Joseph S., Wilm M., Parton RG., Zerial M. Only protein-protein interactions imex curation schnatwinkel-2004-2 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Schnatwinkel C., Christoforidis S., Lindsay MR., Uttenweiler-Joseph S., Wilm M., Parton RG., Zerial M. DIP original experiment: DIP-110925X PLoS biology 2004 IMEx The Rab5 effector Rabankyrin-5 regulates and coordinates different endocytic mechanisms. Schnatwinkel C., Christoforidis S., Lindsay MR., Uttenweiler-Joseph S., Wilm M., Parton RG., Zerial M. Only protein-protein interactions imex curation schnatwinkel-2004-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Schnatwinkel C., Christoforidis S., Lindsay MR., Uttenweiler-Joseph S., Wilm M., Parton RG., Zerial M. DIP original experiment: DIP-110923X PLoS biology 2004 IMEx The Rab5 effector Rabankyrin-5 regulates and coordinates different endocytic mechanisms. Schnatwinkel C., Christoforidis S., Lindsay MR., Uttenweiler-Joseph S., Wilm M., Parton RG., Zerial M. Only protein-protein interactions imex curation schnatwinkel-2004-4 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Schnatwinkel C., Christoforidis S., Lindsay MR., Uttenweiler-Joseph S., Wilm M., Parton RG., Zerial M. DIP original experiment: DIP-110924X PLoS biology 2004 IMEx The Rab5 effector Rabankyrin-5 regulates and coordinates different endocytic mechanisms. Schnatwinkel C., Christoforidis S., Lindsay MR., Uttenweiler-Joseph S., Wilm M., Parton RG., Zerial M. Only protein-protein interactions imex curation rab5a_human Ras-related protein Rab-5A RAB5A RAB5 protein protein human Homo sapiens Human MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN brabankyrin5 PREDICTED: similar to ankyrin repeat and FYVE domain containing 1 protein protein bovin Bos taurus (Bovine) Bovine anfy1_human Rabankyrin-5 Ankyrin repeat and FYVE domain-containing protein 1 ANKFY1 ANKHZN KIAA1255 Ankyrin repeats hooked to a zinc finger motif protein protein human Homo sapiens Human MAEEEVAKLEKHLMLLRQEYVKLQKKLAETEKRCALLAAQANKESSSESFISRLLAIVADLYEQEQYSDLKIKVGDRHISAHKFVLAARSDSWSLANLSSTKELDLSDANPEVTMTMLRWIYTDELEFREDDVFLTELMKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNASTLMNYCAEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTEYPLHKAIKVEREDVVFLYLIEMDSQLPGKLNEADHNGDLALDLALSRRLESIATTLVSHKADVDMVDKSGWSLLHKGIQRGDLFAATFLIKNGAFVNAATLGAQETPLHLVALYSSKKHSADVMSEMAQIAEALLQAGANPNMQDSKGRTPLHVSIMAGNEYVFSQLLQCKQLDLELKDHEGSTALWLAVQHITVSSDQSVNPFEDVPVVNGTSFDENSFAARLIQRGSHTDAPDTATGNCLLQRAAGAGNEAAALFLATNGAHVNHRNKWGETPLHTACRHGLANLTAELLQQGANPNLQTEEALPLPKEAASLTSLADSVHLQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTGMHTIAAQLLGSGAAINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVRTQDGETALQLAIRNQLPLVVDAICTRGADMSVPDEKGNPPLWLALANNLEDIASTLVRHGCDATCWGPGPGGCLQTLLHRAIDENNEPTACFLIRSGCDVNSPRQPGANGEGEEEARDGQTPLHLAASWGLEETVQCLLEFGANVNAQDAEGRTPIHVAISSQHGVIIQLLVSHPDIHLNVRDRQGLTPFACAMTFKNNKSAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNSRVQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLENGVDFAAVDENGNNALHLAVMHGRLNNIRVLLTECTVDAEAFNLRGQSPLHILGQYGKENAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYECTARFGVTTRKHHCRHCGRLLCHKCSTKEIPIIKFDLNKPVRVCNICFDVLTLGGVS rab5a-brabankyrin5-1 3137108 N/A 3137112 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3137113 unspecified role unspecified role prey prey bovin Bos taurus (Bovine) Bovine physical association physical association false false false rab5a-ankfy1-1 3137109 N/A 3137114 unspecified role unspecified role prey prey in vitro In vitro N/A 3137112 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false rab5a-brabankyrin5-2 3137110 N/A 3137112 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3137113 unspecified role unspecified role prey prey bovin Bos taurus (Bovine) Bovine physical association physical association false false false rab5a-ankfy1-2 3137111 N/A 3137114 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3137112 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false