UniProt UniProt http://www.uniprot.org rubin_bejerano-2004-1 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rubin-Bejerano I., Sagee S., Friedman O., Pnueli L., Kassir Y. ykassir@techunix.technion.ac.il Molecular and cellular biology 2004 imex curation Only protein-protein interactions imex curation ime1_yeast Meiosis-inducing protein 1 IME1 J1916 YJR094C protein protein yeast Saccharomyces cerevisiae Baker's yeast MQADMHGKLHAALEDGFFLFPFEQQQQPNIYYDTTTDQEDRPCFSFGSTISPRSWHFEKSDKIASSQLQNLVHTQPIHLINPQILFNEEFLNLENIDSQPISKETKTTKDCTMATGPERGKKSSESTRSSSLSSLFSNDESASTFHSSFNNHDNFQKSNRNGDDIDISDTIKYETNTNAQKDIKIFQENFEFNEFPYTQDFYPYTTNYTYSKPTNIHESINSKNTDSYSQYQDQFPPHTDNIHSFNNRHYSNHKSTNCNYYNNTSNNNNASDNVYEADPFIDEPQVPSYYYPLEIAFDVEKSPPPSLQKLNSKELEFLKKLNSKLSRYAAAYSFSSSNDQDYYDKVRFQEISYKFSKTYS ume6_yeast Transcriptional regulatory protein UME6 UME6 CAR80 CARGR1 YDR207C YD8142.04C Unscheduled meiotic gene expression protein 6 Negative transcriptional regulator of IME2 Regulator of inducer of meiosis protein 16 NIM2 RIM16 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLDKARSQSKHMDESNAAASLLSMETTANNHHYLHNKTSRATLMNSSQDGKKHAEDEVSDGANSRHPTISSASIESLKTTYDENPLLSIMKSTCAPNNTPVHTPSGSPSLKVQSGGDIKDDPKENDTTTTTNTTLQDRRDSDNAVHAAASPLAPSNTPSDPKSLCNGHVAQATDPQISGAIQPQYTATNEDVFPYSSTSTNSNTATTTIVAGAKKKIHLPPPQAPAVSSPGTTAAGSGAGTGSGIRSRTGSDLPLIITSANKNNGKTTNSPMSILSRNNSTNNNDNNSIQSSDSRESSNNNEIGGYLRGGTKRGGSPSNDSQVQHNVHDDQCAVGVAPRNFYFNKDREITDPNVKLDENESKINISFWLNSKYRDEAYSLNESSSNNASSNTDTPTNSRHANTSSSITSRNNFQHFRFNQIPSQPPTSASSFTSTNNNNPQRNNINRGEDPFATSSRPSTGFFYGDLPNRNNRNSPFHTNEQYIPPPPPKYINSKLDGLRSRLLLGPNSASSSTKLDDDLGTAAAVLSNMRSSPYRTHDKPISNVNDMNNTNALGVPASRPHSSSFPSKGVLRPILLRIHNSEQQPIFESNNSTAVFDEDQDQNQDLSPYHLNLNSKKVLDPTFESRTRQVTWNKNGKRIDRRLSAPEQQQQLEVPPLKKSRRSVGNARVASQTNSDYNSLGESSTSSAPSSPSLKASSGLAYTADYPNATSPDFAKSKGKNVKPKAKSKAKQSSKKRPNNTTSKSKANNSQESNNATSSTSQGTRSRTGCWICRLRKKKCTEERPHCFNCERLKLDCHYDAFKPDFVSDPKKKQMKLEEIKKKTKEAKRRAMKKK 0DDA0A6B4A157182 ime1-ume6-1 3322616 N/A 3322617 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P21190:p.Tyr359Phe mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P21190:p.Ser302Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P21190:p.Ser302Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P21190:p.Ser306Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P21190:p.Ser333Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P21190:p.Ser337Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P21190:p.[Ser352Ala;Ser356Ala;Ser360Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 3322618 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 3322630 3322622 physical association physical association false false false Fig. 7 Interaction was not observed in RIM11-/- cells