IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ flaig-2004-1 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Flaig RM., Stark S., Watzl C. Details of isoleucine-zipper fusion protein vector -pZipH, taken from pmid:15680159 Binding of ILZ fusion proteins was detected with anti-ILZ. carsten.watzl@urz.uni-heidelberg.de Journal of immunology (Baltimore, Md. : 1950) 2004 imex curation Only protein-protein interactions cd48_human CD48 antigen B-lymphocyte activation marker BLAST-1 BCM1 surface antigen Leukocyte antigen MEM-102 TCT.1 CD48 BCM1 BLAST1 SLAM family member 2 Signaling lymphocytic activation molecule 2 protein protein human Homo sapiens Human MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT cd244_human Natural killer cell receptor 2B4 NK cell type I receptor protein 2B4 NK cell activation-inducing ligand CD244 2B4 SLAM family member 4 Signaling lymphocytic activation molecule 4 protein protein human Homo sapiens Human MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSRKELENFDVYS slaf7_human SLAM family member 7 SLAMF7 CS1 CD2 subset 1 CD2-like receptor-activating cytotoxic cells Membrane protein FOAP-12 Novel Ly9 Protein 19A UNQ576/PRO1138 protein protein human Homo sapiens Human MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLLLVPLLLSLFVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGENTEYDTIPHTNRTILKEDPANTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI nctr3_human Natural cytotoxicity triggering receptor 3 NCR3 1C7 LY117 Activating natural killer receptor p30 Natural killer cell p30-related protein protein protein human Homo sapiens Human MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG slaf6_human SLAM family member 6 KALI SLAMF6 Activating NK receptor NK-T-B-antigen UNQ6123/PRO20080 protein protein human Homo sapiens Human MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLSTQRTQGPAESARNLEYVSVSPTNNTVYASVTHSNRETEIWTPRENDTITIYSTINHSKESKPTFSRATALDNVV cd244-cd48-2 2971054 N/A 2971055 unspecified role unspecified role prey prey n_terminal_Ig_kappa_signal_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecd sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminal_isoleucine-zipper tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 2971056 unspecified role unspecified role bait bait physical association physical association false false false 1-1 CD48 is held at the cell surface by a GPI anchor via a C-terminal domain which can be cleaved to yield a soluble form of the receptor. slamf7-cd48-1 2971054 N/A 2971057 unspecified role unspecified role prey prey n_terminal_Ig_kappa_signal_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecd sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminal_isoleucine-zipper tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 2971057 unspecified role unspecified role bait bait physical association physical association false false false 1-2 slamf7-ncr3-1 2971054 N/A 2971058 unspecified role unspecified role prey prey n_terminal_Ig_kappa_signal_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecd sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminal_isoleucine-zipper tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 2971057 unspecified role unspecified role bait bait physical association physical association false false false 1-3 slamf7-ncr3-2 2971054 N/A 2971058 unspecified role unspecified role prey prey n_terminal_Ig_kappa_signal_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecd sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminal_isoleucine-zipper tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 2971059 unspecified role unspecified role bait bait physical association physical association false false false 1-4 slamf6-ncr3-1 2971054 N/A 2971059 unspecified role unspecified role prey prey n_terminal_Ig_kappa_signal_sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecd sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminal_isoleucine-zipper tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 2971059 unspecified role unspecified role bait bait physical association physical association false false false 1-5