DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kobor-2004-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast density sedimentation cosedimentation through density gradient density sedimentation anti tag western anti tag western blot anti tag western Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132380X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132400X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132392X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132397X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap predetermined predetermined participant predetermined Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132388X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132384X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132398X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap predetermined predetermined participant predetermined Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132391X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap predetermined predetermined participant predetermined Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132387X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132395X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap predetermined predetermined participant predetermined Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132382X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap predetermined predetermined participant predetermined Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132394X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132381X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-14 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132383X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132390X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-16 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap predetermined predetermined participant predetermined Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132402X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-17 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132396X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-18 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132399X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-19 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap predetermined predetermined participant predetermined Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132386X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-20 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132385X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-21 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap predetermined predetermined participant predetermined Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132393X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-22 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap predetermined predetermined participant predetermined Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132389X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation kobor-2004-23 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. DIP original experiment: DIP-132401X PLoS biology 2004 IMEx A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin. Kobor MS., Venkatasubrahmanyam S., Meneghini MD., Gin JW., Jennings JL., Link AJ., Madhani HD., Rine J. Only protein-protein interactions imex curation vps71_yeast Vacuolar protein sorting-associated protein 71 YML041C YM8054.02C VPS71 SWC6 SWR complex protein 6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKALVEEIDKKTYNPDIYFTSLDPQARRYTSKKINKQGTISTSRPVKRINYSLADLEARLYTSRSEGDGNSISRQDDRNSKNSHSFEERYTQQEILQSDRRFMELNTENFSDLPNVPTLLSDLTGVPRDRIESTTKPISQTSDGLSALMGGSSFVKEHSKYGHGWVLKPETLREIQLSYKSTKLPKPKRKNTNRIVALKKVLSSKRNLHSFLDSALLNLMDKNVIYHNVYNKRYFKVLPLITTCSICGGYDSISSCVNCGNKICSVSCFKLHNETRCRNR D95B57C72ACB648A swc4_yeast SWR1-complex protein 4 SWC4 EAF2 GOD1 ESA1-associated factor 2 YGR002C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSDIFDVLNIKQKSRSPTNGQVSVPSSSAANRPKPQVTGMQRELFNLLGENQPPVVIKSGNNFKEKMLSTSKPSPWSFVEFKANNSVTLRHWVKGSKELIGDTPKESPYSKFNQHLSIPSFTKEEYEAFMNENEGTQKSVESEKNHNENFTNEKKDESKNSWSFEEIEYLFNLCKKYDLRWFLIFDRYSYNNSRTLEDLKEKFYYTCRNYFKASDPSNPLLSSLNFSAEKEIERKKYLQRLLSRSAAEIAEEEALVVESKKFEMAAKRTLAERESLLRLLDSPHSDQTITQYLTSQGMSQLYNALLADKTRKRKHDLNIPENPWMKQQQQFAQHRQLQQLNVKKSEVKENLSPKKTKRQRQEMQTALKRKSESAYAEQLLKDFNSDERKALGVITHGEKLSPGVYLRSTKLSTFKPALQNKILAILQELSLPSRPVMPSFDVMERQEELLKKINTLIDLKKHVDKYEAGMSITK 512CB8DF3171E7A3 arp4_yeast Actin-related protein 4 ARP4 ACT3 YJL081C J1012 Actin-like protein ARP4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNAALQVYGGDEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKYTADEGNKKIFSEQSIGIPRKDYELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSLYDYANNRGFFQECKETLCHICPTKTLEETKTELSSTAKRSIESPWNEEIVFDNETRYGFAEELFLPKEDDIPANWPRSNSGVVKTWRNDYVPLKRTKPSGVNKSDKKVTPTEEKEQEAVSKSTSPAANSADTPNETGKRPLEEEKPPKENNELIGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTGHTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRFR 6DE1C8938C6C3DBB swc3_yeast SWR1-complex protein 3 SWC3 FUN36 SWC1 YAL011W protein protein yeast Saccharomyces cerevisiae Baker's yeast MPAVLRTRSKESSIEQKPASRTRTRSRRGKRGRDDDDDDDDEESDDAYDEVGNDYDEYASRAKLATNRPFEIVAGLPASVELPNYNSSLTHPQSIKNSGVLYDSLVSSRRTWVQGEMFELYWRRPKKIVSESTPAATESPTSGTIPLIRDKMQKMCDCVMSGGPHTFKVRLFILKNDKIEQKWQDEQELKKKEKELKRKNDAEAKRLRMEERKRQQMQKKIAKEQKLQLQKENKAKQKLEQEALKLKRKEEMKKLKEQNKNKQGSPSSSMHDPRMIMNLNLMAQEDPKLNTLMETVAKGLANNSQLEEFKKFIEIAKKRSLEENPVNKRPSVTTTRPAPPSKAKDVAEDHRLNSITLVKSSKTAATEPEPKKADDENAEKQQSKEAKTTAESTQVDVKKEEEDVKEKGVKSEDTQKKEDNQVVPKRKRRKNAIKEDKDMQLTAFQQKYVQGAEIILEYLEFTHSRYYLPKKSVVEFLEDTDEIIISWIVIHNSKEIEKFKTKKIKAKLKADQKLNKEDAKPGSDVEKEVSFNPLFEADCPTPLYTPMTMKLSGIHKRFNQIIRNSVSPMEEVVKEMEKILQIGTRLSGYNLWYQLDGYDDEALSESLRFELNEWEHAMRSRRHKR A4F13DB85B657D59 vps72_yeast Vacuolar protein sorting-associated protein 72 SWR complex protein 2 VPS72 SWC2 YDR485C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDEGADKSLDTNTEFIIQTRSRRSNAGNKLQKLLEQELRDIESTKRQISSYKNGNDDEEDEIGLLFQEDEDDEDFEMMAKDDDDEGEEKEDETQSIRKEPSQASSEQAADDLMFSSSESEDSSNENDEDAEEKEIRRQELLSRKKRNKRLQKGPVVIKKQKPKPKSGEAIPRSHHTHEQLNAETLLLNTRRTSKRSSVMENTMKVYEKLSKAEKKRKIIQERIRKHKEQESQHMLTQEERLRIAKETEKLNILSLDKFKEQEVWKKENRLALQKRQKQKFQPNETILQFLSTAWLMTPAMELEDRKYWQEQLNKRDKKKKKYPRKPKKNLNLGKQDASDDKKRESEESIKNDGDVNSLGENSSSVHNQKRIEETSTNDTVEGESSPDAAVSRVNSDELKPTALPDVTLDAIANKQSTVDEAPNSQPQKNIITNEQKITNVGEPIQNLHNEEIKDEMVSALESRENTFENSSPAAQVVSQRDNSATPTPSNSTGTEDTILISPDTDIKGEPEPCLKTEGIENLSHNVPQETKSNTDVSFLKQVTFTDHPQVAIIDTEESPSKKDTANVDESSAENSLSTQTYEGPEQLTSRNFVTLYDFPNAPPNLKDFNTNLFGDRWSYTNGLSATQRPQDMKTVFHSILPSPPQSSVPSPTVDISLDLSALANFPSFGEYDKKIVHQINTEINKDLEIKIKTQPPTGVFLANGIRKKCLITNKECQYFDPRTGVPYSDVEAYKIIQRIQDPISKEEGRSDIKRDETTNEDSDDQVRFKWFGFKNGGIYLDLSQRPAKGVPEGF 6D3053EBB610DB95 swr1_yeast Helicase SWR1 Swi2/Snf2-related 1 SWR1 YDR334W D9651.6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTTSRKSHAKDKKAGGEQDLADLKFRYDLLTNELFHLREFVSLVDYDPTHFNDSESFQKFLRETHLSLEERGEKFTDDVAKKGTNGDLTRRRRNLRTSTVVSSETTNEKKGDIELKLESIAPLVRNKCEELKYKLSDHSNRKSIVPQKRPIQHLKKREAAKSLKFKSERKENPLPLHEHIAEERYDHIAKVEEPSEAFTIKCPSDDSSFENTSEHYSDNFYFTTSSEEEDIKKKRGRKKKKPRIKLVVHPPKQTITNPLHVVKPGYESLHEYIASFKSLEDDLTLEEYNKYIDEQRRLLSRLKKGIENGALKYDKETDSLQPITSKEIKTIITYKPDPISYFYKQQDLQIHTDHLINQGIHMSKLFRSSTKARIARAKKVSQMIEQHFKHVAGAEERKAKEEERHKKSLARFAVQAVKKRWNMAEKAYRILRKDEEEQLKRIEGKQHLSKMLEKSTQLLEAQLNQVNDDGRSSTPSSDSNDVLSESDDDMDDELSTSSDEDEEVDADVGLENSPASTEATPTDESLNLIQLKEKYGHFNGSSTVYDSRNKDEKFPTLDKHESSSSESSVMTGEESSIYSSSENESQNENDRESDDKTPSVGLSALFGKGEESDGDLDLDDSEDFTVNSSSVEGEELEKDQVDNSAATFERAGDFVHTQNENRDDIKDVEEDAETKVQEEQLSVVDVPVPSLLRGNLRTYQKQGLNWLASLYNNHTNGILADEMGLGKTIQTISLLAYLACEKENWGPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKRKGWNKPDAFHVCIVSYQLVVQDQHSFKRKRWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGTPLQNNLAELWSLLYFLMPQTVIDGKKVSGFADLDAFQQWFGRPVDKIIETGQNFGQDKETKKTVAKLHQVLRPYLLRRLKADVEKQMPAKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMSIVNCLMQLRKVCNHPNLFEVRPILTSFVLEHCVASDYKDVERTLLKLFKKNNQVNRVDLDFLNLVFTLNDKDLTSYHAEEISKLTCVKNFVEEVNKLRETNKQLQEEFGEASFLNFQDANQYFKYSNKQKLEGTVDMLNFLKMVNKLRCDRRPIFGKNLIDLLTKDRRVKYDKSSIIDNELIKPLQTRVLDNRKIIDTFAVLTPSAVSLDMRKLALGLNDDSSVGENTRLKVMQNCFEVSNPLHQLQTKLTIAFPDKSLLQYDCGKLQKLAILLQQLKDNGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQILTERFNTDSRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKKANQKRQLDNVVIQEGDFTTDYFSKLSVRDLLGSELPENASGGDKPLIADADVAAKDPRQLERLLAQAEDEDDVKAANLAMREVEIDNDDFDESTEKKAANEEEENHAELDEYEGTAHVDEYMIRFIANGYYY 156E3BB5978905C8 swc7_yeast SWR1-complex protein 7 SWC7 AWS1 YLR385C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDCPSNVVLLLLQLVLQRQQTLAHRDKSVDLQTLLKDPVIDNDVLVEFKTHKLVQLYGPQYCRDISLRGLKTMVTDIFANGIPKNAQSSGNDQPVTVVDLANYYYMQRINELQNTELPQLKEALLTRLEHMI 92CCE2FF3DCE72F1 bdf1_yeast Bromodomain-containing factor 1 L8084.18 YLR399C BDF1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTDITPVQNDVDVNGNNVNDDVSSNLKRPIDQGDPSNGLAEEENPANNQLHLKKARLDGDALTSSPAGLAENGIEGATLAANGENGYNATGSGAEDEQQGLKKEEGGQGTKQEDLDENSKQELPMEVPKEPAPAPPPEPDMNNLPQNPIPKHQQKHALLAIKAVKRLKDARPFLQPVDPVKLDIPFYFNYIKRPMDLSTIERKLNVGAYEVPEQITEDFNLMVNNSIKFNGPNAGISQMARNIQASFEKHMLNMPAKDAPPVIAKGRRSSAQEDAPIVIRRAQTHNGRPKRTIHPPKSKDIYPYESKKPKSKRLQQAMKFCQSVLKELMAKKHASYNYPFLEPVDPVSMNLPTYFDYVKEPMDLGTIAKKLNDWQYQTMEDFERDVRLVFKNCYTFNPDGTIVNMMGHRLEEVFNSKWADRPNLDDYDSDEDSRTQGDYDDYESEYSESDIDETIITNPAIQYLEEQLARMKVELQQLKKQELEKIRKERRLARGSKKRGKRSKGRSGSKNASSKGRRDKKNKLKTVVTYDMKRIITERINDLPTSKLERAIDIIKKSMPNISEDDEVELDLDTLDNHTILTLYNTFFRQYESSSGASNGLDGTSGVTRDASSLSPTSAGSRKRRSKALSQEEQSRQIEKIKNKLAILDSASPLSQNGSPGQIQSAAHNGFSSSSDDDVSSESEEE 8CCD52F41F91D0DA imb5_yeast Importin subunit beta-5 KAP114 YGL241W HRC1004 Karyopherin subunit beta-5 Karyopherin-114 114 kDa karyopherin protein protein yeast Saccharomyces cerevisiae Baker's yeast MDINELIIGAQSADKHTREVAETQLLQWCDSDASQVFKALANVALQHEASLESRQFALLSLRKLITMYWSPGFESYRSTSNVEIDVKDFIREVLLKLCLNDNENTKIKNGASYCIVQISAVDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLATMEIVFKVLNTETSTLIAKIAALKLLKACLLQMSSHNEYDEASRKSFVSQCLATSLQILGQLLTLNFGNVDVISQLKFKSIIYENLVFIKNDFSRKHFSSELQKQFKIMAIQDLENVTHINANVETTESEPLLETVHDCSIYIVEFLTSVCTLQFSVEEMNKIITSLTILCQLSSETREIWTSDFNTFVSKETGLAASYNVRDQANEFFTSLPNPQLSLIFKVVSNDIEHSTCNYSTLESLLYLLQCILLNDDEITGENIDQSLQILIKTLENILVSQEIPELILARAILTIPRVLDKFIDALPDIKPLTSAFLAKSLNLALKSDKELIKSATLIAFTYYCYFAELDSVLGPEVCSETQEKVIRIINQVSSDAEEDTNGALMEVLSQVISYNPKEPHSRKEILQAEFHLVFTISSEDPANVQVVVQSQECLEKLLDNINMDNYKNYIELCLPSFINVLDSNNANNYRYSPLLSLVLEFITVFLKKKPNDGFLPDEINQYLFEPLAKVLAFSTEDETLQLATEAFSYLIFNTDTRAMEPRLMDIMKVLERLLSLEVSDSAAMNVGPLVVAIFTRFSKEIQPLIGRILEAVVVRLIKTQNISTEQNLLSVLCFLTCNDPKQTVDFLSSFQIDNTDALTLVMRKWIEAFEVIRGEKRIKENIVALSNLFFLNDKRLQKVVVNGNLIPYEGDLIITRSMAKKMPDRYVQVPLYTKIIKLFVSELSFQSKQPNPEQLITSDIKQEVVNANKDDDNDDWEDVDDVLDYDKLKEYIDDDVDEEADDDSDDITGLMDVKESVVQLLVRFFKEVASKDVSGFHCIYETLSDSERKVLSEALL 1F4C02AA6AB2FF39 h2az_yeast Histone H2A.Z HTZ1 H2AZ YOL012C HTA3 O2345 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGKAHGGKGKSGAKDSGSLRSQSSSARAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEKKGSKK 1D8FCEE3C8A504E7 eaf1_yeast Chromatin modification-related protein EAF1 VID21 YDR359C EAF1 Vacuolar import and degradation protein 21 ESA1-associated factor 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSRPSSAVPNSASLSEDQSSDRSKFPKADDLIDERDRKLTELYCVSRLNQLLELTDENKLRKEIDAFLKKNDIRRGIRFDEASLPKLLHTAATPITKKKLKDVNLINVPNQRLSDSKMSRELPENSENVSVKSESHFVPSHDNSIRENMMDSLRPAEKTGGMWNKRPLESTMGGEEERHEKRQKMQSQSLESSNNSEMASLPISPRPPVPNALAHYTYYENIEYPPADPTEVQPAVKFKDPLIKNIMAKEIDTSDHYNENNVDALETVFLLMNDYIPSKIPQALPLAELKYMSQTLPLINLIPRAHKALTTNIINNALNEARITVVGSRIEELRRLGLWSLRQPKRFIDPWKQHNTHQNILLEEAKWMQADFKEGHKYKVAICTAMAQAIKDYWTYGEICCVKRKTLLPGKENKLSDDGRISEKSGRPSDTSRNDSDISIAGKDDIGIIANVDDITEKESAAANDNDENGKNEAGAKSDFDFADGLLSQEGAHDQIISSIDTKLLLKKPSSSSEVVLIQHEVAASSALIETEESKKELAPPFKLSIFVDELNTFEKTLIQDLPLYNGINEERPKKDDSLPFIPISKSVVSLDDNGFYKLLERQLIDEEPSISQLSKRRGMFYGNRRNHYLRPPAVPSLRYLQNRTPTIWLSEDDQELVKNINTYGYNWELISAHMTHRLTYSYLSNIERRTPWQCFERFVQLNERFNFSDLKGPRAHSAQQWLIEAHKFQQRQNRRISPLGVNTESIQRGHRRLRWASMFEAIRKCMKKRENTPRPNPTQPRKPLDCKNMKVPTPAEMSLLKAQRDEALRRDIQLRRTVKNRLQQRQQQSQQAHSSRAQSPIPSNGKSSSNLARNGQASAPRPNQKQYTEQDIIESYSRKLLEQKPDIGPEMALKAAKNYYRTLREQQQQLKQHQIQQQRQQLQEESSHVQQLQQLQPGSQAPPPKSSPSQSSLSNISNINSAPRIKSPTPQEILQRFQKQ 75F0C9594EF4ED8D esa1_yeast Histone acetyltransferase ESA1 ESA1 O5257 YOR244W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSHDGKEEPGIAKKINSVDDIIIKCQCWVQKNDEERLAEILSINTRKAPPKFYVHYVNYNKRLDEWITTDRINLDKEVLYPKLKATDEDNKKQKKKKATNTSETPQDSLQDGVDGFSRENTDVMDLDNLNVQGIKDENISHEDEIKKLRTSGSMTQNPHEVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPVFTASQLRFAW 9E970F744D0B9E18 tra1_yeast Transcription-associated protein 1 TRA1 p400 kDa component of SAGA YHR099W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLTEQIEQFASRFRDDDATLQSRYSTLSELYDIMELLNSPEDYHFFLQAVIPLLLNQLKEVPISYDAHSPEQKLRNSMLDIFNRCLMNQTFQPYAMEVLEFLLSVLPKENEENGILCMKVLTTLFKSFKSILQDKLDSFIRIIIQIYKNTPNLINQTFYEAGKAEQGDLDSPKEPQADELLDEFSKNDEEKDFPSKQSSTEPRFENSTSSNGLRSSMFSFKILSECPITMVTLYSSYKQLTSTSLPEFTPLIMNLLNIQIKQQQEAREQAESRGEHFTSISTEIINRPAYCDFILAQIKATSFLAYVFIRGYAPEFLQDYVNFVPDLIIRLLQDCPSELSSARKELLHATRHILSTNYKKLFLPKLDYLFDERILIGNGFTMHETLRPLAYSTVADFIHNIRSELQLSEIEKTIKIYTGYLLDESLALTVQIMSAKLLLNLVERILKLGKENPQEAPRAKKLLMIIIDSYMNRFKTLNRQYDTIMKYYGRYETHKKEKAEKLKNSIQDNDKESEEFMRKVLEPSDDDHLMPQPKKEDINDSPDVEMTESDKVVKNDVEMFDIKNYAPILLLPTPTNDPIKDAFYLYRTLMSFLKTIIHDLKVFNPPPNEYTVANPKLWASVSRVFSYEEVIVFKDLFHECIIGLKFFKDHNEKLSPETTKKHFDISMPSLPVSATKDARELMDYLAFMFMQMDNATFNEIIEQELPFVYERMLEDSGLLHVAQSFLTSEITSPNFAGILLRFLKGKLKDLGNVDFNTSNVLIRLFKLSFMSVNLFPNINEVVLLPHLNDLILNSLKYSTTAEEPLVYFYLIRTLFRSIGGGRFENLYRSIKPILQVLLQSLNQMILTARLPHERELYVELCITVPVRLSVLAPYLPFLMKPLVFALQQYPDLVSQGLRTLELCIDNLTAEYFDPIIEPVIDDVSKALFNLLQPQPFNHAISHNVVRILGKLGGRNRQFLKPPTDLTEKTELDIDAIADFKINGMPEDVPLSVTPGIQSALNILQSYKSDIHYRKSAYKYLTCVLLLMTKSSAEFPTNYTELLKTAVNSIKLERIGIEKNFDLEPTVNKRDYSNQENLFLRLLESVFYATSIKELKDDAMDLLNNLLDHFCLLQVNTTLLNKRNYNGTFNIDLKNPNFMLDSSLILDAIPFALSYYIPEVREVGVLAYKRIYEKSCLIYGEELALSHSFIPELAKQFIHLCYDETYYNKRGGVLGIKVLIDNVKSSSVFLKKYQYNLANGLLFVLKDTQSEAPSAITDSAEKLLIDLLSITFADVKEEDLGNKVLENTLTDIVCELSNANPKVRNACQKSLHTISNLTGIPIVKLMDHSKQFLLSPIFAKPLRALPFTMQIGNVDAITFCLSLPNTFLTFNEELFRLLQESIVLADAEDESLSTNIQKTTEYSTSEQLVQLRIACIKLLAIALKNEEFATAQQGNIRIRILAVFFKTMLKTSPEIINTTYEALKGSLAENSKLPKELLQNGLKPLLMNLSDHQKLTVPGLDALSKLLELLIAYFKVEIGRKLLDHLTAWCRVEVLDTLFGQDLAEQMPTKIIVSIINIFHLLPPQADMFLNDLLLKVMLLERKLRLQLDSPFRTPLARYLNRFHNPVTEYFKKNMTLRQLVLFMCNIVQRPEAKELAEDFEKELDNFYDFYISNIPKNQVRVVSFFTNMVDLFNTMVITNGDEWLKKKGNMILKLKDMLNLTLKTIKENSFYIDHLQLNQSIAKFQALYLRFTELSERDQNPLLLDFIDFSFSNGIKASYSLKKFIFHNIIASSNKEKQNNFINDATLFVLSDKCLDARIFVLKNVINSTLIYEVATSGSLKSYLVEDKKPKWLELLHNKIWKNSNAILAYDVLDHHDLFRFELLQLSAIFIKADPEIIAEIKKDIIKFCWNFIKLEDTLIKQSAYLVTSYFISKFDFPIKVVTQVFVALLRSSHVEARYLVKQSLDVLTPVLHERMNAAGTPDTWINWVKRVMVENSSSQNNILYQFLISHPDLFFNSRDLFISNIIHHMNKITFMSNSNSDSHTLAIDLASLILYWENKTLEITNVNNTKTDSDGDVVMSDSKSDINPVEADTTAIIVDANNNSPISLHLREACTAFLIRYVCASNHRAIETELGLRAINILSELISDKHWTNVNVKLVYFEKFLIFQDLDSENILYYCMNALDVLYVFFKNKTKEWIMENLPTIQNLLEKCIKSDHHDVQEALQKVLQVIMKAIKAQGVSVIIEEESPGKTFIQMLTSVITQDLQETSSVTAGVTLAWVLFMNFPDNIVPLLTPLMKTFSKLCKDHLSISQPKDAMALEEARITTKLLEKVLYILSLKVSLLGDSRRPFLSTVALLIDHSMDQNFLRKIVNMSRSWIFNTEIFPTVKEKAAILTKMLAFEIRGEPSLSKLFYEIVLKLFDQEHFNNTEITVRMEQPFLVGTRVEDIGIRKRFMTILDNSLERDIKERLYYVIRDQNWEFIADYPWLNQALQLLYGSFNREKELSLKNIYCLSPPSILQEYLPENAEMVTEVNDLELSNFVKGHIASMQGLCRIISSDFIDSLIEIFYQDPKAIHRAWVTLFPQVYKSIPKNEKYGFVRSIITLLSKPYHTRQISSRTNVINMLLDSISKIESLELPPHLVKYLAISYNAWYQSINILESIQSNTSIDNTKIIEANEDALLELYVNLQEEDMFYGLWRRRAKYTETNIGLSYEQIGLWDKAQQLYEVAQVKARSGALPYSQSEYALWEDNWIQCAEKLQHWDVLTELAKHEGFTDLLLECGWRVADWNSDRDALEQSVKSVMDVPTPRRQMFKTFLALQNFAESRKGDQEVRKLCDEGIQLSLIKWVSLPIRYTPAHKWLLHGFQQYMEFLEATQIYANLHTTTVQNLDSKAQEIKRILQAWRDRLPNTWDDVNMWNDLVTWRQHAFQVINNAYLPLIPALQQSNSNSNINTHAYRGYHEIAWVINRFAHVARKHNMPDVCISQLARIYTLPNIEIQEAFLKLREQAKCHYQNMNELTTGLDVISNTNLVYFGTVQKAEFFTLKGMFLSKLRAYEEANQAFATAVQIDLNLAKAWAQWGFFNDRRLSEEPNNISFASNAISCYLQAAGLYKNSKIRELLCRILWLISIDDASGMLTNAFDSFRGEIPVWYWITFIPQLLTSLSHKEANMVRHILIRIAKSYPQALHFQLRTTKEDFAVIQRQTMAVMGDKPDTNDRNGRRQPWEYLQELNNILKTAYPLLALSLESLVAQINDRFKSTTDEDLFRLINVLLIDGTLNYNRLPFPRKNPKLPENTEKNLVKFSTTLLAPYIRPKFNADFIDNKPDYETYIKRLRYWRRRLENKLDRASKKENLEVLCPHLSNFHHQKFEDIEIPGQYLLNKDNNVHFIKIARFLPTVDFVRGTHSSYRRLMIRGHDGSVHSFAVQYPAVRHSRREERMFQLYRLFNKSLSKNVETRRRSIQFNLPIAIPLSPQVRIMNDSVSFTTLHEIHNEFCKKKGFDPDDIQDFMADKLNAAHDDALPAPDMTILKVEIFNSIQTMFVPSNVLKDHFTSLFTQFEDFWLFRKQFASQYSSFVFMSYMMMINNRTPHKIHVDKTSGNVFTLEMLPSRFPYERVKPLLKNHDLSLPPDSPIFHNNEPVPFRLTPNIQSLIGDSALEGIFAVNLFTISRALIEPDNELNTYLALFIRDEIISWFSNLHRPIIENPQLREMVQTNVDLIIRKVAQLGHLNSTPTVTTQFILDCIGSAVSPRNLARTDVNFMPWF AE3588676F5D5777 ruvb2_yeast RuvB-like protein 2 TIP49-homology protein 2 TIP49b homolog RVB2 TIH2 TIP49B YPL235W P1060 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIQTSDPNETSDLKSLSLIAAHSHITGLGLDENLQPRPTSEGMVGQLQARRAAGVILKMVQNGTIAGRAVLVAGPPSTGKTALAMGVSQSLGKDVPFTAIAGSEIFSLELSKTEALTQAFRKSIGIKIKEETELIEGEVVEIQIDRSITGGHKQGKLTIKTTDMETIYELGNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGADTRFVQCPEGELQKRKTVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVMMATNRGVSKTRGTNYKSPHGLPLDLLDRSIIITTKSYNEQEIKTILSIRAQEEEVELSSDALDLLTKTGVETSLRYSSNLISVAQQIAMKRKNNTVEVEDVKRAYLLFLDSARSVKYVQENESQYIDDQGNVQISIAKSADPDAMDTTE 0D8EFBA7EC711AB8 swc5_yeast SWR1-complex protein 5 YBR231C YBR1529 SWC5 AOR1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPEVETKIIPNEKEDEDEDGYIEEEDEDFQPEKDKLGGGSDDSDASDGGDDYDDGVNRDKGRNKVDYSRIESESGGLIKTRRARQAEEEYAKTHKYESLTVESIPAKVNSIWEELQEASKNRLLSSSGKVGSVLDGSKEARSTTAAQQEDKILIERNYKFAGETVHEKKWVSRSSAEGQEYLNSLKFKQQAPAAPVQLEKAVRTKSNESRQHLRRPLKRPPLLEQIISGGLRPKLTTLEKSQLDWASYVDRAGLNDELVLHNKDGFLARQEFLQRVGSAEDERYKELRRQQLAQQLQQDSEAS 985F66B3E3CB3F25 af9_yeast Protein AF-9 homolog N1966 YNL107W YAF9 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAPTISKRIKTLSVSRPIIYGNTAKKMGSVKPPNAPAEHTHLWTIFVRGPQNEDISYFIKKVVFKLHDTYPNPVRSIEAPPFELTETGWGEFDINIKVYFVEEANEKVLNFYHRLRLHPYANPVPNSDNGNEQNTTDHNSKDAEVSSVYFDEIVFNEPNEEFFKILMSRPGNLLPSNKTDDCVYSKQLEQEEIDRIEIGIEKVDKEIDELKQKLENLVKQEAINGS 1FE08F72942061D1 yng2_yeast Chromatin modification-related protein YNG2 YHR090C YNG2 EAF4 NBN1 ING1 homolog 2 ESA1-associated factor 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDPSLVLEQTIQDVSNLPSEFRYLLEEIGSNDLKLIEEKKKYEQKESQIHKFIRQQGSIPKHPQEDGLDKEIKESLLKCQSLQREKCVLANTALFLIARHLNKLEKNIALLEEDGVLAPVEEDGDMDSAAEASRESSVVSNSSVKKRRAASSSGSVPPTLKKKKTSRTSKLQNEIDVSSREKSVTPVSPSIEKKIARTKEFKNSRNGKGQNGSPENEEEDKTLYCFCQRVSFGEMVACDGPNCKYEWFHYDCVNLKEPPKGTWYCPECKIEMEKNKLKRKRN 110E0A2536547D03 eaf3_yeast Chromatin modification-related protein EAF3 EAF3 YPR023C YP9367.03C ESA1-associated factor 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVDLEQEFALGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPNDKPGGSSQATKEIKPQKLGEDESIPEEIINGKCFFIHYQGWKSSWDEWVGYDRIRAYNEENIAMKKRLANEAKEAKKSLLEQQKKKKLSTSLGGPSNGGKRKGDSRSNASISKSTSQSFLTSSVSGRKSGRSSANSLHPGSSLRSSSDQNGNDDRRRSSSLSPNMLHHIAGYPTPKISLQIPIKLKSVLVDDWEYVTKDKKICRLPADVTVEMVLNKYEHEVSQELESPGSQSQLSEYCAGLKLYFDKCLGNMLLYRLERLQYDELLKKSSKDQKPLVPIRIYGAIHLLRLISVLPELISSTTMDLQSCQLLIKQTEDFLVWLLMHVDEYFNDKDPNRSDDALYVNTSSQYEGVALGM 63758DE9510D70DC epl1_yeast Enhancer of polycomb-like protein 1 EPL1 YFL024C protein protein yeast Saccharomyces cerevisiae Baker's yeast MPTPSNAIEINDGSHKSGRSTRRSGSRSAHDDGLDSFSKGDSGAGASAGSSNSRFRHRKISVKQHLKIYLPNDLKHLDKDELQQREVVEIETGVEKNEEKEVHLHRILQMGSGHTKHKDYIPTPDASMTWNEYDKFYTGSFQETTSYIKFSATVEDCCGTNYNMDERDETFLNEQVNKGSSDILTEDEFEILCSSFEHAIHERQPFLSMDPESILSFEELKPTLIKSDMADFNLRNQLNHEINSHKTHFITQFDPVSQMNTRPLIQLIEKFGSKIYDYWRERKIEVNGYEIFPQLKFERPGEKEEIDPYVCFRRREVRHPRKTRRIDILNSQRLRALHQELKNAKDLALLVAKRENVSLNWINDELKIFDQRVKIKNLKRSLNISGEDDDLINHKRKRPTIVTVEQREAELRKAELKRAAAAAAAAKAKNNKRNNQLEDKSSRLTKQQQQQLLQQQQQQQQNALKTENGKQLANASSSSTSQPITSHVYVKLPSSKIPDIVLEDVDALLNSKEKNARKFVQEKMEKRKIEDADVFFNLTDDPFNPVFDMSLPKNFSTSNVPFASIASSKFQIDRSFYSSHLPEYLKGISDDIRIYDSNGRSRNKDNYNLDTKRIKKTELYDPFQENLEIHSREYPIKFRKRVGRSNIKYVDRMPNFTTSSTKSACSLMDFVDFDSIEKEQYSREGSNDTDSINVYDSKYDEFVRLYDKWKYDSPQNEYGIKFSDEPARLNQISNDTQVIRFGTMLGTKSYEQLREATIKYRRDYITRLKQKHIQHLQQQQQQQQQQQQQAQQQKQKSQNNNSNSSNSLKKLNDSLINSEAKQNSSITQKNSS E08689465F84ABA8 act_yeast Actin ACT1 ABY1 END7 YFL039C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 87AC19B0B0BC9E71 ruvb1_yeast RuvB-like protein 1 RVB1 TIP49-homology protein 1 TIP49a homolog TIH1 TIP49A YDR190C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAISEVKENPGVNSSNSGAVTRTAAHTHIKGLGLDESGVAKRVEGGFVGQIEAREACGVIVDLIKAKKMSGRAILLAGGPSTGKTALALAISQELGPKVPFCPLVGSELYSVEVKKTETLMENFRRAIGLRIKETKEVYEGEVTELTPEDAENPLGGYGKTISHVIVGLKSAKGTKTLRLDPTIYESIQREKVSIGDVIYIEANTGAVKRVGRSDAYATEFDLETEEYVPLPKGEVHKKKEIVQDVTLHDLDVANARPQGGQDVISMMGQLLKPKKTEITEKLRQEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNKALESNIAPVVVLASNRGMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDKDEIRTIIERRATVERLQVESSALDLLATMGTETSLRYALQLLAPCGILAQTSNRKEIVVNDVNEAKLLFLDAKRSTKILETSANYL 93D6ECB7006AF0F2 h2b1_yeast Histone H2B.1 HTB1 H2B1 SPT12 YDR224C YD9934.09C Suppressor of Ty protein 12 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAKAEKKPASKAPAEKKPAAKKTSTSTDGKKRSKARKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQA 9F5E9CFB341DB399 nap1_yeast Nucleosome assembly protein NAP1 YKR048C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDPIRTKPKSSMQIDNAPTPHNTPASVLNPSYLKNGNPVRAQAQEQDDKIGTINEEDILANQPLLLQSIQDRLGSLVGQDSGYVGGLPKNVKEKLLSLKTLQSELFEVEKEFQVEMFELENKFLQKYKPIWEQRSRIISGQEQPKPEQIAKGQEIVESLNETELLVDEEEKAQNDSEEEQVKGIPSFWLTALENLPIVCDTITDRDAEVLEYLQDIGLEYLTDGRPGFKLLFRFDSSANPFFTNDILCKTYFYQKELGYSGDFIYDHAEGCEISWKDNAHNVTVDLEMRKQRNKTTKQVRTIEKITPIESFFNFFDPPKIQNEDQDEELEEDLEERLALDYSIGEQLKDKLIPRAVDWFTGAALEFEFEEDEEEADEDEDEEEDDDHGLEDDDGESAEEQDDFAGRPEQAPECKQS C0F97FBA1B9EEA83 ies3_yeast Ino eighty subunit 3 IES3 L2131 YLR052W protein protein yeast Saccharomyces cerevisiae Baker's yeast MKFEDLLATNKQVQFAHAATQHYKSVKTPDFLEKDPHHKKFHNADGLNQQGSSTPSTATDANAASTASTHTNTTTFKRHIVAVDDISKMNYEMIKNSPGNVITNANQDEIDISTLKTRLYKDNLYAMNDNFLQAVNDQIVTLNAAEQDQETEDPDLSDDEKIDILTKIQENLLEEYQKLSQKERKWFILKELLLDANVELDLFSNRGRKASHPIAFGAVAIPTNVNANSLAFNRTKRRKINKNGLLENIL 5A0A2229D6C87ABF ies2_yeast Ino eighty subunit 2 N1315 YNL215W IES2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSEASDIEAELSDSVSAGGEEYIDDDDYTEDIDDQIVTAKSSRRTARRSVPKGVRTSKRIRDKELSVEVDEDYDEEEDVLSPSKKRHLHTRSMDKRQVAATASEKSDIGDSKGNDGEIEDGILEEEESLEKELNRGGGKEVEKSEESYYAQNDVGQKGEEEQDGESGGYEDNEPSISKESDELVSVVNGNGNEEDDEVEATKENTTDSTRSTTTRSKMLLDLLEDGGSKKKLTDEEIQLRRAENARKRKNLSEKRLEEEKQDTINKLLKKRAGKSRSHLPNDDEKNDGSSSFVKPRRPYNSEGMTRILRRYEEDLFCTF 6F0AA04387A3B3E8 ies1_yeast Ino eighty subunit 1 IES1 YFL013C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGKRVYDPIHDTFQLREDNSDETKADSPMQSVKSGSQEEASPSSIQSETETVTTKSIPVIHEIEIDDKNDDDSTQSEEENTNILLNFEPSTVPEATGASTATGPVTTNTVRRKPKESNASKYNRHLKKPDGEPFNRKDIQFSFMQELLMDKRQIFTNVLKPLYKNSIVPINIDGDKLSINVTDKEYDARTFVFNDKLTFAQLYVLTIATSIKCSKILRDKLLLDQQVAFSTCVLALLVNIGRLNTTINFYLEMTSQLRTFHSVPVLQLHANDPKLLQDTPRLKSILKNLPWGNEQLSLMETYKKVDQNDGEVDTVNKFNIINMLFSICDNSGLIDKRFLSKYVEVESKAQEQDMVDEQNEVKETEAENEKQESKAAYATTLFDILDYSKYEPKDRSNILIWLLYIHLETNLSQEEVEESVRFFNGLEDGAPAGKFILRCTERSYDTDPEDELEFGANQRIKRREFMSKMEEGRKRERTNVTEVKKPSIGGDKSEEDGEGEDDKSEETVEETRSLLTPTPILESSSPMTLNRKKVTPQLPKVTPAAPTETEEEITSAAIIDKNDLNLTPLKKYNSSATVNKVDKLISLDLNKHVSENGKTQEEFLADLKKSQVPNRLKRRDIGLIKIFNEFEDIPVASVLGIRGKKRKKFKDNLLGFETDFMKNLGASKKVLLNKIERAEIDDEEATAMFKLE 9C0084A36431B241 ino80_yeast Chromatin-remodeling ATPase INO80 YGL150C G1880 INO80 Inositol-requiring protein 80 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLAVLLNKEDKDISDFSKTTAGKSAKKNSRERVADVAPTRVLDKKQAYLSQLNSEFNRIKRRDSIEQLYQDWKFINLQEFELISEWNQQSKDWQFDNTNDSQDLHFKKLYRDMSMINKEWAEYQSFKNANLSDIINEKDADEDEEDDEDELEDGEEDMEEDEASTGRHTNGKSMRGNGIQKSRKKDAAAAAAIGKAIKDDQTHADTVVTVNGDENEDGNNGEDEDNDNDNENNNDNDNDNENENDNDSDNDDEEENGEEDEEEEEIEDLDEEDFAAFEEQDDNDDEDFNPDVEKRRKRSSSSSSSTKLSMNSLSLITSKKINKNITINSDRPKIVRELIKMCNKNKHQKIKKRRFTNCIVTDYNPIDSKLNIKITLKQYHVKRLKKLINDAKREREREEALKNNVGLDGNDLDNDEDGSESHKRRKLNNNTANGADDANKRKFNTRHGLPTYGMKMNAKEARAIQRHYDNTYTTIWKDMARKDSTKMSRLVQQIQSIRSTNFRKTSSLCAREAKKWQSKNFKQIKDFQTRARRGIREMSNFWKKNEREERDLKKKIEKEAMEQAKKEEEEKESKRQAKKLNFLLTQTELYSHFIGRKIKTNELEGNNVSSNDSESQKNIDISALAPNKNDFHAIDFDNENDEQLRLRAAENASNALAETRAKAKQFDDHANAHEEEEEEDELNFQNPTSLGEITIEQPKILACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAENHNIWGPFLVVTPASTLHNWVNEISKFLPQFKILPYWGNANDRKVLRKFWDRKNLRYNKNAPFHVMVTSYQMVVTDANYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIMPSLFDSHDEFNEWFSKDIESHAEANTKLNQQQLRRLHMILKPFMLRRVKKNVQSELGDKIEIDVLCDLTQRQAKLYQVLKSQISTNYDAIENAATNDSTSNSASNSGSDQNLINAVMQFRKVCNHPDLFERADVDSPFSFTTFGKTTSMLTASVANNNSSVISNSNMNLSSMSSNNISNGKFTDLIYSSRNPIKYSLPRLIYEDLILPNYNNDVDIANKLKNVKFNIFNPSTNYELCLFLSKLTGEPSLNEFFRVSTTPLLKRVIERTNGPKNTDSLSFKTITQELLEVTRNAPSEGVMASLLNVEKHAYEREYLNCIQRGYHPNVSAPPVTIEVLGSSHVTNSINNELFDPLISQALSDIPAITQYNMHVKKGIPVEDFPKTGLFPEPLNKNFSSNISMPSMDRFITESAKLRKLDELLVKLKSEGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRDLVHDWQTNPEIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLVRGTIEERMRDRAKQKEQVQQVVMEGKTQEKNIKTIEVGENDSEVTREGSKSISQDGIKEAASALA 017053C5A245337E arp4-swc2-1 3136798 N/A 3136821 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136822 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136823 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136824 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136825 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136826 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false htz1-bdf1-1 3136799 N/A 3136827 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136828 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136829 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136830 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136822 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136824 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136825 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false swr1-bdf1-1 3136800 N/A 3136828 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136826 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false esa1-eaf1-1 3136801 N/A 3136831 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136832 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136833 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false rvb2-swc4-2 3136802 N/A 3136834 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136822 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false swc4-act1-1 3136803 N/A 3136834 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136822 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136823 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136826 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136835 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136836 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136827 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136837 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136838 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136832 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136824 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136831 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136825 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136839 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136833 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136821 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136840 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136841 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false swr1-act1-1 3136804 N/A 3136840 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136826 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136842 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false swc4-esa1-1 3136805 N/A 3136822 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136832 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136833 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false esa1-swc4-1 3136806 N/A 3136832 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136833 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136822 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false yaf9-eaf1-1 3136807 N/A 3136831 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136836 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136833 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false h2a.z-act1-1 3136808 N/A 3136834 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136822 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136823 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136826 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136830 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136836 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136835 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136843 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136828 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136825 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136839 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136829 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136833 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136821 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136840 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136841 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false yaf9-bdf1-1 3136809 N/A 3136836 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136828 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rvb2-act1-2 3136810 N/A 3136844 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136845 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136846 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136847 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136827 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136821 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136840 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136841 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136834 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136822 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136823 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136826 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false swr1-act1-2 3136811 N/A 3136827 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136824 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136836 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136835 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136825 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136821 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136840 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136841 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136834 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136822 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136823 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136826 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false yaf9-esa1-1 3136812 N/A 3136832 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136836 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136833 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false yaf9-bdf1-2 3136813 N/A 3136836 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136833 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136826 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136827 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136828 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136822 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136824 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136825 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false swc4-eaf1-1 3136814 N/A 3136831 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136822 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136833 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false swr1-act1-3 3136815 N/A 3136830 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136840 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136826 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false yaf9-swc4-1 3136816 N/A 3136836 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136833 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136822 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false yaf9-act1-1 3136817 N/A 3136828 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136837 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136838 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136832 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136831 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136836 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136825 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136839 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136833 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136840 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136841 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136834 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136822 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136823 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136826 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false swc4-bdf1-1 3136818 N/A 3136822 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136828 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false swr1-swc4-5 3136819 N/A 3136826 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136822 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false h2a.z-bdf1-1 3136820 N/A 3136826 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136830 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136827 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136828 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136829 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136822 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136824 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3136825 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false