UniProt UniProt http://www.uniprot.org kee-2004-1 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kee K., Protacio RU., Arora C., Keeney S. s-keeney@ski.mskcc.org The EMBO journal 2004 imex curation Only protein-protein interactions imex curation kee-2004-2 yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kee K., Protacio RU., Arora C., Keeney S. s-keeney@ski.mskcc.org The EMBO journal 2004 imex curation Only protein-protein interactions imex curation to6bl_yeast Meiotic recombination protein REC102 L8543.17 YLR329W REC102 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARDITFLTVFLESCGAVNNDEAGKLLSAWTSTVRIEGPESTDSNSLYIPLLPPGMLKIKLNFKMNDRLVTEEQELFTKLREIVGSSIRFWEEQLFYQVQDVSTIENHVILSLKCTILTDAQISTFISKPRELHTHAKGYPEIYYLSELSTTVNFFSKEGNYVEISQVIPHFNEYFSSLIVSQLEFEYPMVFSMISRLRLKWQQSSLAPISYALTSNSVLLPIMLNMIAQDKSSTTAYQILCRRRGPPIQNFQIFSLPAVTYNK re104_yeast Meiotic recombination protein REC104 REC104 YHR157W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIEEEDTNKITCTQDFLHQYFVTERVSIQFGLNNKTVKRINKDEFDKAVNCIMSWTNYPKPGLKRTASTYLLSNSFKKSATVSLPFILGDPVCMPKRVESNNNDTCLLYSDTLYDDPLIQRNDQAGDEIEDEFSFTLLRSEVNEIRPISSSSTAQILQSDYSALMYERQASNGSIFQFSSP rec102-re104_yeast-1 3314656 N/A 3314658 unspecified role unspecified role bait bait N/A 3314659 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1D re104_yeast-rec102-1 3314657 N/A 3314658 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3314659 unspecified role unspecified role bait bait n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 1E