IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ arora-2004-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Arora C., Kee K., Maleki S., Keeney S., Arora C., Kee K., Maleki S., Keeney S. Interactions here were observed in vegetative AND meiotic cultures. Values >10X control values are entered only. s-keeney@ski.mskcc.org Molecular cell 2004 imex curation Only protein-protein interactions imex curation arora-2004-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Arora C., Kee K., Maleki S., Keeney S., Arora C., Kee K., Maleki S., Keeney S. Interactions here were observed in meiotic cultures only. Values >10X control values are entered only. s-keeney@ski.mskcc.org Molecular cell 2004 imex curation Only protein-protein interactions imex curation re114_yeast Meiotic recombination protein REC114 YM9375.02 YMR133W REC114 protein protein yeast Saccharomyces cerevisiae Baker's yeast MYEYCSVVIKKYSKYTIPSFAPNGFQSMLEPPQIDKWQHLSANCTLQFRVLLMDSRQILINVVLNNSTLLENIRLPLGDNQDLIQFSCKSPIISCKYISEEFGPRMLRRFQMNLPNDVEFNRTVVSLKNLNFVLRTARTSIAQSTITSQVQGNNNGTKVCFTEGPKVSSYTNPNTQFQTQNMIMDFSQRYQEESERESNNRSNITLPHDSIQIAQQIWPNTDLNVVQSSQDLNTPMATQTVLGRPESLIVQPLEVSQSPPNTTNCLPNAENKKKKVDTTSDFTSRKEIALCKTGLLETIHIPKERESQMQSVTGLDATPTIIWSPGKDNTAKKNTSNKKNIDDKLTNPQKSGNTHTPDRNKEVLPNGTLNETRKEASPSEGLTIRVKNVNRNASRKISKRLIKEKLKDEEFMKWVNKVETVLNKMFEK mei4_yeast Meiosis-specific protein MEI4 MEI4 YER044BC YER044C-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRGKLEDMEQKETSEVDWIICFALIQSRNPTLWKRALSRKKGDVEDVGALKSEKNLKINPRENSKHIYKWVAPFENGFLNNKSLFAHLEPIYNFLCQNKYKSFEDAVGLKELQSFSKDVSTADINNWFLPRYKILLKILSLKTKEIDFRGLSQVFQTLQILLVSHYSHRIDSDSSFKRTLIDVHVFNFIAKFLFNRILLKKNQNDPKWLQNFYDQGDGKHLCDKVDYKRLCSLHFTLIYSIINIQLIKIKTNQTFEPQILKYVSVLKLIEHILIIIESLIHVLIRFVSKHKLICINRKKAYCRVYLERELSLKKTYLKNFYSVISGVPEKELGGLLKILKIVILSLLETFESIEWQHLKPFLEKFPAHEISLQKKRKYIQAALLITAERNLIARFRLSRWFNETENI re107_yeast Recombination protein 107 MER2 J1462 YJR021C REC107 Meiotic recombination protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVARGRTDEISTDVSEANSEHSLMITETSSPFRSIFSHSGKVANAGALEESDKQILEWAGKLELESMELRENSDKLIKVLNENSKTLCKSLNKFNQLLEQDAATNGNVKTLIKDLASQIENQLDKVSTAMLSKGDEKKTKSDSSYRQVLVEEISRYNSKITRHVTNKQHETEKSMRCTQEMLFNVGSQLEDVHKVLLSLSKDMHSLQTRQTALEMAFREKADHAYDRPDVSLNGTTLLHDMDEAHDKQRKKSVPPPRMMVTRSMKRRRSSSPTLSTSQNHNSEDNDDASHRLKRAARTIIPWEELRPDTLESEL 46F426AC0DFDFAD0 rad50_yeast DNA repair protein RAD50 RAD50 YNL250W N0872 153 kDa protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAIYKLSIQGIRSFDSNDRETIEFGKPLTLIVGMNGSGKTTIIECLKYATTGDLPPNSKGGVFIHDPKITGEKDIRAQVKLAFTSANGLNMIVTRNIQLLMKKTTTTFKTLEGQLVAINNSGDRSTLSTRSLELDAQVPLYLGVPKAILEYVIFCHQEDSLWPLSEPSNLKKKFDEIFQAMKFTKALDNLKSIKKDMSVDIKLLKQSVEHLKLDKDRSKAMKLNIHQLQTKIDQYNEEVSEIESQLNEITEKSDKLFKSNQDFQKILSKVENLKNTKLSISDQVKRLSNSIDILDLSKPDLQNLLANFSKVLMDKNNQLRDLETDISSLKDRQSSLQSLSNSLIRRQGELEAGKETYEKNRNHLSSLKEAFQHKFQGLSNIENSDMAQVNHEMSQFKAFISQDLTDTIDQFAKDIQLKETNLSDLIKSITVDSQNLEYNKKDRSKLIHDSEELAEKLKSFKSLSTQDSLNHELENLKTYKEKLQSWESENIIPKLNQKIEEKNNEMIILENQIEKFQDRIMKTNQQADLYAKLGLIKKSINTKLDELQKITEKLQNDSRIRQVFPLTQEFQRADLEMDFQKLFINMQKNIAINNKKMHELDRRYTNALYNLNTIEKDLQDNQKSKEKVIQLLSENLPEDCTIDEYNDVLEETELSYKTALENLKMHQTTLEFNRKALEIAERDSCCYLCSRKFENESFKSKLLQELKTKTDANFEKTLKDTVQNEKEYLHSLRLLEKHIITLNSINEKIDNSQKCLEKAKEETKTSKSKLDELEVDSTKLKDEKELAESEIRPLIEKFTYLEKELKDLENSSKTISEELSIYNTSEDGIQTVDELRDQQRKMNDSLRELRKTISDLQMEKDEKVRENSRMINLIKEKELTVSEIESSLTQKQNIDDSIRSKRENINDIDSRVKELEARIISLKNKKDEAQSVLDKVKNERDIQVRNKQKTVADINRLIDRFQTIYNEVVDFEAKGFDELQTTIKELELNKAQMLELKEQLDLKSNEVNEEKRKLADSNNEEKNLKQNLELIELKSQLQHIESEISRLDVQNAEAERDKYQEESLRLRTRFEKLSSENAGKLGEMKQLQNQIDSLTHQLRTDYKDIEKNYHKEWVELQTRSFVTDDIDVYSKALDSAIMKYHGLKMQDINRIIDELWKRTYSGTDIDTIKIRSDEVSSTVKGKSYNYRVVMYKQDVELDMRGRCSAGQKVLASIIIRLALSETFGANCGVIALDEPTTNLDEENIESLAKSLHNIINMRRHQKNFQLIVITHDEKFLGHMNAAAFTDHFFKVKRDDRQKSQIEWVDINRVTY 58A0AA173AC5677E mre11_yeast Double-strand break repair protein MRE11 YM9959.06C YMR224C MRE11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDYPDPDTIRILITTDNHVGYNENDPITGDDSWKTFHEVMMLAKNNNVDMVVQSGDLFHVNKPSKKSLYQVLKTLRLCCMGDKPCELELLSDPSQVFHYDEFTNVNYEDPNFNISIPVFGISGNHDDASGDSLLCPMDILHATGLINHFGKVIESDKIKVVPLLFQKGSTKLALYGLAAVRDERLFRTFKDGGVTFEVPTMREGEWFNLMCVHQNHTGHTNTAFLPEQFLPDFLDMVIWGHEHECIPNLVHNPIKNFDVLQPGSSVATSLCEAEAQPKYVFILDIKYGEAPKMTPIPLETIRTFKMKSISLQDVPHLRPHDKDATSKYLIEQVEEMIRDANEETKQKLADDGEGDMVAELPKPLIRLRVDYSAPSNTQSPIDYQVENPRRFSNRFVGRVANGNNVVQFYKKRSPVTRSKKSGINGTSISDRDVEKLFSESGGELEVQTLVNDLLNKMQLSLLPEVGLNEAVKKFVDKDEKTALKEFISHEISNEVGILSTNEEFLRTDDAEEMKALIKQVKRANSVRPTPPKENDETNFAFNGNGLDSFRSSNREVRTGSPDITQSHVDNESRITHISQAESSKPTSKPKRVRTATKKKIPAFSDSTVISDAENELGDNNDAQDDVDIDENDIIMVSTDEEDASYGLLNGRKTKTKTRPAASTKTASRRGKGRASRTPKTDILGSLLAKKRK D58433E32E852B73 xrs2_yeast DNA repair protein XRS2 XRS2 D9481.13 YDR369C protein protein yeast Saccharomyces cerevisiae Baker's yeast MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNSSDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEVWNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMKKSRFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVLTTIKSEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILCTIKTMLTSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSRAPEVEASPVVSKKRKLNRRRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAESKTVISSPNIAEADEKHAPFLQNALKPTEDIGKKSGHSSPGAIIVSSPNLGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGSQTISSNSADYETAAVNSMDDAEVTKNFRVNHHQNIEQPSKNIRKLSNYSREISSPLQENCKSPVKELSIKEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNNTQSSDFIRNAAFLITRNYVPLKKYSKKDTTTKWGTEENEDMFALTEMERFGSNTFMSDNINSNTIQKRSQALNRFTNEDSSNEGEEDSFSFSRCSGTAASVQPLKNKIFITDEDDLGDIDDKSDRLNHRENNRNLFVVKEMNLRPNLSEECSKQSRHSRSATSRSRGSFGASNNGDGDDDDDDGPKFTFKRRKG 833DAD6D20F6693E re104_yeast Meiotic recombination protein REC104 REC104 YHR157W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIEEEDTNKITCTQDFLHQYFVTERVSIQFGLNNKTVKRINKDEFDKAVNCIMSWTNYPKPGLKRTASTYLLSNSFKKSATVSLPFILGDPVCMPKRVESNNNDTCLLYSDTLYDDPLIQRNDQAGDEIEDEFSFTLLRSEVNEIRPISSSSTAQILQSDYSALMYERQASNGSIFQFSSP spo11_yeast Meiosis-specific protein SPO11 SPO11 Sporulation-specific protein 11 YHL022C protein protein yeast Saccharomyces cerevisiae Baker's yeast MALEGLRKKYKTRQELVKALTPKRRSIHLNSNGHSNGTPCSNADVLAHIKHFLSLAANSLEQHQQPISIVFQNKKKKGDTSSPDIHTTLDFPLNGPHLCTHQFKLKRCAILLNLLKVVMEKLPLGKNTTVRDIFYSNVELFQRQANVVQWLDVIRFNFKLSPRKSLNIIPAQKGLVYSPFPIDIYDNILTCENEPKMQKQTIFPGKPCLIPFFQDDAVIKLGTTSMCNIVIVEKEAVFTKLVNNYHKLSTNTMLITGKGFPDFLTRLFLKKLEQYCSKLISDCSIFTDADPYGISIALNYTHSNERNAYICTMANYKGIRITQVLAQNNEVHNKSIQLLSLNQRDYSLAKNLIASLTANSWDIATSPLKNVIIECQREIFFQKKAEMNEIDARIFEYK ski8_yeast Antiviral protein SKI8 YGL213C SKI8 REC103 Superkiller protein 8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKVFIATANAGKAHDADIFSVSACNSFTVSCSGDGYLKVWDNKLLDNENPKDKSYSHFVHKSGLHHVDVLQAIERDAFELCLVATTSFSGDLLFYRITREDETKKVIFEKLDLLDSDMKKHSFWALKWGASNDRLLSHRLVATDVKGTTYIWKFHPFADESNSLTLNWSPTLELQGTVESPMTPSQFATSVDISERGLIATGFNNGTVQISELSTLRPLYNFESQHSMINNSNSIRSVKFSPQGSLLAIAHDSNSFGCITLYETEFGERIGSLSVPTHSSQASLGEFAHSSWVMSLSFNDSGETLCSAGWDGKLRFWDVKTKERITTLNMHCDDIEIEEDILAVDEHGDSLAEPGVFDVKFLKKGWRSGMGADLNESLCCVCLDRSIRWFREAGGK C5E7B9D2268F9727 to6bl_yeast Meiotic recombination protein REC102 L8543.17 YLR329W REC102 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARDITFLTVFLESCGAVNNDEAGKLLSAWTSTVRIEGPESTDSNSLYIPLLPPGMLKIKLNFKMNDRLVTEEQELFTKLREIVGSSIRFWEEQLFYQVQDVSTIENHVILSLKCTILTDAQISTFISKPRELHTHAKGYPEIYYLSELSTTVNFFSKEGNYVEISQVIPHFNEYFSSLIVSQLEFEYPMVFSMISRLRLKWQQSSLAPISYALTSNSVLLPIMLNMIAQDKSSTTAYQILCRRRGPPIQNFQIFSLPAVTYNK mre11_human Double-strand break repair protein MRE11 MRE11 Double-strand break repair protein MRE11A HNGS1 MRE11A Meiotic recombination 11 homolog 1 Meiotic recombination 11 homolog A protein protein human Homo sapiens Human MSTADALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSKFPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCALDILSCAGFVNHFGRSMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITKPSEGTTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDEEVRRFRETRQKNTNEEDDEVREAMTRARALRSQSEESASAFSADDLMSIDLAEQMANDSDDSISAATNKGRGRGRGRRGGRGQNSASRGGSQRGRADTGLETSTRSRNSKTAVSASRNMSIIDAFKSTRQQPSRNVTTKNYSEVIEVDESDVEEDIFPTTSKTDQRWSSTSSSKIMSQSQVSKGVDFESSEDDDDDPFMNTSSLRRNRR 2354235345w4-1 3322334 N/A 3322336 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c_terminus gal4 ad gal4 activation domain gal4 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3322337 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supplementary table 1-1 mei4-rec114-7 3322334 N/A 3322336 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c_terminus gal4 ad gal4 activation domain gal4 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3322337 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus lexa dna bd lexa dna binding domain lexa dna bd c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supplementary table 1-2 mei4-rec114-8 3322334 N/A 3322338 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c_terminus gal4 ad gal4 activation domain gal4 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3322337 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus lexa dna bd lexa dna binding domain lexa dna bd c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supplementary table 1-3 mei4-rec107-1 3322334 N/A 3322338 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3322337 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus lexa dna bd lexa dna binding domain lexa dna bd c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supplementary table 1-4 mei4-rec114-10 3322334 N/A 3322339 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3322340 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supplementary table 1-6 mre11-rad50-23 3322334 N/A 3322339 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3322340 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus lexa dna bd lexa dna binding domain lexa dna bd c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supplementary table 1-7 mre11-rad50-24 3322334 N/A 3322341 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3322340 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus lexa dna bd lexa dna binding domain lexa dna bd c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supplementary table 1-8 mei4-rec114-11 3322334 N/A 3322338 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c_terminus gal4 ad gal4 activation domain gal4 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3322338 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supplementary table 1-9 rec107-rec107-1 3322334 N/A 3322338 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3322338 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supplementary table 1-10 rec107-rec107-2 3322334 N/A 3322338 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3322338 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus lexa dna bd lexa dna binding domain lexa dna bd c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supplementary table 1-12 rec107-rec107-3 3322334 N/A 3322338 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c_terminus gal4 ad gal4 activation domain gal4 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3322338 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus lexa dna bd lexa dna binding domain lexa dna bd c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supplementary table 1-11 rec107-rec107-4 3322334 N/A 3322336 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c_terminus gal4 ad gal4 activation domain gal4 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3322342 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus lexa dna bd lexa dna binding domain lexa dna bd c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supplementary table 1-13 rec104-rec114-1 3322334 N/A 3322336 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c_terminus gal4 ad gal4 activation domain gal4 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3322336 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus lexa dna bd lexa dna binding domain lexa dna bd c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supplementary table 1-14 mei4-rec107-2 3322334 N/A 3322343 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3322344 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus lexa dna bd lexa dna binding domain lexa dna bd c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supplementary table 1-15 mre11-rad50-25 3322334 N/A 3322338 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3322341 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supplementary table 1-16 ski8-spo11-1 3322334 N/A 3322343 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed n_terminus gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P23179:p.Gln376Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P23179:p.Arg377_Glu378delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false N/A 3322344 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed c_terminus lexa dna bd lexa dna binding domain lexa dna bd c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figure 6B spo11-ski8-1 3322334 N/A 3322344 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c_terminus gal4 ad gal4 activation domain gal4 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3322343 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus lexa dna bd lexa dna binding domain lexa dna bd c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supplementary table 1-5 mre11-rad50-26 3322334 N/A 3322338 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed N/A 3322340 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed physical association physical association false false false Figure 1B-1 weak interaction mre11-rec107-1 3322334 N/A 3322342 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed N/A 3322340 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed physical association physical association false false false Figure 1B-2 weak interaction mre11-rec104-1 3322334 N/A 3322336 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed N/A 3322345 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed physical association physical association false false false Figure 1B-3 weak interaction rec102-rec104-2 3322334 N/A 3322342 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed N/A 3322345 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed physical association physical association false false false Figure 1B-5 weak interaction rec102-rec104-3 3322334 N/A 3322342 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed N/A 3322342 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed physical association physical association false false false Figure 1B-4 weak interaction rec104-rec104-1 3322334 N/A 3322338 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed N/A 3322344 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed physical association physical association false false false Figure 1B-6 weak interaction rec107-ski8-1 3322334 N/A 3322336 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed N/A 3322344 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed physical association physical association false false false Figure 1B-7 weak interaction mre11-rec107-2 3322334 N/A 3322338 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed N/A 3322342 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed physical association physical association false false false Figure 1B-8 weak interaction rec104-rec107-1 3322334 N/A 3322345 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed N/A 3322342 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed physical association physical association false false false Figure 1B-9 weak interaction mei4-rec114-12 3322335 N/A 3322336 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c_terminus gal4 ad gal4 activation domain gal4 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3322338 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus lexa dna bd lexa dna binding domain lexa dna bd c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supplementary table 2-1 rec107-rec114-1 3322335 N/A 3322342 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c_terminus gal4 ad gal4 activation domain gal4 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3322343 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supplementary table 2-2 spo11-rec104-3 3322335 N/A 3322342 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3322343 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supplementary table 2-4 spo11-rec104-4 3322335 N/A 3322344 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c_terminus gal4 ad gal4 activation domain gal4 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3322343 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supplementary table 2-3 spo11-rec104-5 3322335 N/A 3322343 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3322342 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supplementary table 2-5 spo11-rec104-6 3322335 N/A 3322342 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322344 unspecified role unspecified role ancillary ancillary over-expressed over expressed level over-expressed N/A 3322343 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 7B-1 The GAL4-AD fusion could be N or C terminal- not stated. spo11-rec104-7 3322335 N/A 3322342 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322345 unspecified role unspecified role ancillary ancillary over-expressed over expressed level over-expressed N/A 3322343 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 7B-2 The GAL4-AD fusion could be N or C terminal- not stated. spo11-rec104-8 3322335 N/A 3322343 unspecified role unspecified role ancillary ancillary over-expressed over expressed level over-expressed N/A 3322342 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322344 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary table 2-weak, Figure 7C-1 It is not possible to identify if fusions were N or C terminal. ski8-rec104-2 3322335 N/A 3322343 unspecified role unspecified role ancillary ancillary over-expressed over expressed level over-expressed N/A 3322342 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3322344 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary table 2-weak, Figure 7C-2 It is not possible to identify if fusions were N or C terminal. ski8-rec102-1 3322335 N/A 3322345 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed N/A 3322346 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed physical association physical association false false false Figure 1B -weak1 weak interaction mre11-rec102-1 3322335 N/A 3322346 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed N/A 3322342 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed physical association physical association false false false Figure 1B -weak2 weak interaction mre11-rec102-2 3322335 N/A 3322342 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region gal4 ad gal4 activation domain gal4 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3322337 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus lexa dna bd lexa dna binding domain lexa dna bd c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figure 1B -weak weak interaction