DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cheng-2004-1 xenla Xenopus laevis (African clawed frog) African clawed frog anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cheng SK., Olale F., Brivanlou AH., Schier AF. DIP original experiment: DIP-110892X PLoS biology 2004 IMEx Lefty blocks a subset of TGFbeta signals by antagonizing EGF-CFC coreceptors. Cheng SK., Olale F., Brivanlou AH., Schier AF. Only protein-protein interactions imex curation cheng-2004-2 xenla Xenopus laevis (African clawed frog) African clawed frog anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cheng SK., Olale F., Brivanlou AH., Schier AF. DIP original experiment: DIP-110897X PLoS biology 2004 IMEx Lefty blocks a subset of TGFbeta signals by antagonizing EGF-CFC coreceptors. Cheng SK., Olale F., Brivanlou AH., Schier AF. Only protein-protein interactions imex curation cheng-2004-3 xenla Xenopus laevis (African clawed frog) African clawed frog anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cheng SK., Olale F., Brivanlou AH., Schier AF. DIP original experiment: DIP-110890X PLoS biology 2004 IMEx Lefty blocks a subset of TGFbeta signals by antagonizing EGF-CFC coreceptors. Cheng SK., Olale F., Brivanlou AH., Schier AF. Only protein-protein interactions imex curation cheng-2004-4 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheng SK., Olale F., Brivanlou AH., Schier AF. DIP original experiment: DIP-110894X PLoS biology 2004 IMEx Lefty blocks a subset of TGFbeta signals by antagonizing EGF-CFC coreceptors. Cheng SK., Olale F., Brivanlou AH., Schier AF. Only protein-protein interactions imex curation cheng-2004-5 xenla Xenopus laevis (African clawed frog) African clawed frog anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cheng SK., Olale F., Brivanlou AH., Schier AF. DIP original experiment: DIP-110898X PLoS biology 2004 IMEx Lefty blocks a subset of TGFbeta signals by antagonizing EGF-CFC coreceptors. Cheng SK., Olale F., Brivanlou AH., Schier AF. Only protein-protein interactions imex curation cheng-2004-6 xenla Xenopus laevis (African clawed frog) African clawed frog anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cheng SK., Olale F., Brivanlou AH., Schier AF. DIP original experiment: DIP-110891X PLoS biology 2004 IMEx Lefty blocks a subset of TGFbeta signals by antagonizing EGF-CFC coreceptors. Cheng SK., Olale F., Brivanlou AH., Schier AF. Only protein-protein interactions imex curation cheng-2004-7 xenla Xenopus laevis (African clawed frog) African clawed frog anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cheng SK., Olale F., Brivanlou AH., Schier AF. DIP original experiment: DIP-110895X PLoS biology 2004 IMEx Lefty blocks a subset of TGFbeta signals by antagonizing EGF-CFC coreceptors. Cheng SK., Olale F., Brivanlou AH., Schier AF. Only protein-protein interactions imex curation cheng-2004-8 xenla Xenopus laevis (African clawed frog) African clawed frog anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cheng SK., Olale F., Brivanlou AH., Schier AF. DIP original experiment: DIP-110893X PLoS biology 2004 IMEx Lefty blocks a subset of TGFbeta signals by antagonizing EGF-CFC coreceptors. Cheng SK., Olale F., Brivanlou AH., Schier AF. Only protein-protein interactions imex curation cheng-2004-9 xenla Xenopus laevis (African clawed frog) African clawed frog anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cheng SK., Olale F., Brivanlou AH., Schier AF. DIP original experiment: DIP-110896X PLoS biology 2004 IMEx Lefty blocks a subset of TGFbeta signals by antagonizing EGF-CFC coreceptors. Cheng SK., Olale F., Brivanlou AH., Schier AF. Only protein-protein interactions imex curation avr2b_mouse Activin receptor type-2B Acvr2b Activin receptor type IIB protein protein mouse Mus musculus Mouse MTAPWAALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEVRQCQRWAGRRDGCADSFKPLPFQDPGPPPPSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQDKQSWQSEREIFSTPGMKHENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQHPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSLIRRSVNGTTSDCLVSLVTSVTNVDLLPKESSI mint On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin A, activin B and inhibin A acv1b_human Activin receptor type-1B ACVRLK4 Activin receptor type IB Serine/threonine-protein kinase receptor R2 Activin receptor-like kinase 4 ACVR1B ALK4 protein protein human Homo sapiens Human MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQDLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKMMRECWYANGAARLTALRIKKTLSQLSVQEDVKI o13144_danre ndr2 ndr1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MFSCGLLSVVLALAVGLVSCTGNLAGFQETLRNKMRAAGRNGGGRAGHGRHLTRYPLYMMHLYRTLLTGDEKHFSHENPTLYESDSVLSLVAKSCHQVGDKFAVTFDMSSISASDDVQRAELRIRLPHLRSELEVDIYHASTPECERSPCEEVRVHLGTLNANPINSTFRSSWRIFNITALLKYWLHQSERVPFEEPTQMPPMAEGHKSVHHPTANRVMMVVYSKQNRAKTSTLIRTAEHSKYVALDRAGGGSEPVPRRHRRNHRTDDRVRDAAAGMIPGVSHEGGEKKPLCKKVDMWVDFDQIGWSDWIVYPKRYNAYRCEGSCPTPVDETFTPTNHAYMQSLLKLHHPDRVPCLSCVPTRLAPLSMLYYENGKMVMRHHEGMVVAECGCH tdgf1_mouse Teratocarcinoma-derived growth factor Cripto growth factor Epidermal growth factor-like Cripto protein Tdgf1 Cripto protein protein mouse Mus musculus Mouse MGYFSSSVVLLVAISSAFEFGPVAGRDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASRTPCQTPSVTTTFMLAGACLFLDMKV q91350_xenla Activin beta-B chain inhbb.L Inhibin beta B chain activin beta B subunit inhbb protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MALLLLPLLLAGLARTCAPSPTPEPGCPSCHPPMEPEMLEAVKRHILTLLHMQDRPNITHMVPRAAMVSALRKLHAGRVREDGNLEIPDLDGHSLPPPGHSTENSAEIITFAETDDVTASRVRLSFTIANEGNQNLFVFQSNLWLYLKLPEVMDKSRRKIRIKVHFQDAFNPDKMNMVEKKVDIRRSGWHTFPLTEAIQSLFEEGERRLNLEVQCDGCGEYSVIPVYVDPGEESHRPFLVVHARLADNKHRIRKRGLECDGHTNLCCRQQFYIDFRLIGWNDWIIAPAGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVDECGCA lfty1_mouse Left-right determination factor 1 Protein lefty-1 Stimulated by retinoic acid gene 3 protein Transforming growth factor beta-4 Lefty1 Ebaf Lefty Stra3 Tgfb4 protein protein mouse Mus musculus Mouse MPFLWLCWALWALSLVSLREALTGEQILGSLLQQLQLDQPPVLDKADVEGMVIPSHVRTQYVALLQHSHASRSRGKRFSQNLREVAGRFLVSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRQKRLSPHSARARVTIEWLRFRDDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSSHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEAPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTSRWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRRLQP q9w6i6_danre Left-right determination factor lft1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MTSVRAACLLCAALFAMARGFTHEDMKDALLKKLGLNEIPQIHKRDLENLVIPTNVKNKYISMLKLHHSRKRRSLPSLAGILRGIPGNADISGEFVYSDTTRQRVVFEMTSRIPENSEVTMAELKLYKKAPHKRSIPERKGHRPVNNARVSIYWVEPQKDGSNRTSLVDSRLIPIHETGWKSFDVTQAVQYWSRSRMEMPMHLEVWIEGERPGSYAAEMAKCVHFTTQDPDDNTLGKPELVLYTLNLEEFGSSGDCENNKDREMCCREQYFINFRALTWTQYWIIEPSGYQAFRCKGGCRQPKRNYGYGERKCAVVESAPLPMMYLVKKGDYTEIEVAEFPNMIVEKCGCAMDNISVV ndr1-acvr1b-1 3136720 N/A 3136729 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3136730 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3136731 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3136732 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog association association false false false acvr2b-acvr1b-1 3136721 N/A 3136729 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3136733 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3136730 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3136732 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog association association false false false tdgf1-ndr1-1 3136722 N/A 3136731 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3136732 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association false false false lefty1-tdgf1-1 3136723 N/A 3136734 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3136732 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse direct interaction direct interaction false false false acvr2b-acvr1b-2 3136724 N/A 3136729 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3136733 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3136730 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog association association false false false lft1-tdgf1-1 3136725 N/A 3136735 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3136732 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association false false false acvr2b-acvr1b-3 3136726 N/A 3136729 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3136730 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3136731 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3136732 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog association association false false false tdgf1-lft1-1 3136727 N/A 3136735 unspecified role unspecified role prey prey Glu-tag Glu-tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3136732 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association false false false acvr2b-acvr1b-4 3136728 N/A 3136729 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3136730 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association false false false