IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bandyopadhyay-2002-1 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Bandyopadhyay J., Lee J., Lee J., Lee JI., Yu JR., Jee C., Cho JH., Jung S., Lee MH., Zannoni S., Singson A., Kim DH., Koo HS., Ahnn J. joohong@kjist.ac.kr Molecular biology of the cell 2002 imex curation Only protein-protein interactions bandyopadhyay-2002-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bandyopadhyay J., Lee J., Lee J., Lee JI., Yu JR., Jee C., Cho JH., Jung S., Lee MH., Zannoni S., Singson A., Kim DH., Koo HS., Ahnn J. joohong@kjist.ac.kr Molecular biology of the cell 2002 imex curation Only protein-protein interactions calcium(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) canb_caeel Protein phosphatase 2B regulatory subunit cnb-1 Calcineurin subunit B F55C10.1 cnb-1 protein protein caeel Caenorhabditis elegans MGADASLPMEMCSNFDAYELRRLTRRFKKLDVDGSGSLSVEEFMSLPELQQNPLVQRVIDIFDEDGNGEVDFREFIQGISQFSVKGDKNTKLKFAFRIYDMDRDGFISNGELFQVLKMMVGNNLKDSQLQQIVDKTILFHDKDGDGKISFQEFCDVVEHTEVHKKMVLENI q20203_caeel Calsequestrin csq-1 CELE_F40E10.3 F40E10.3 protein protein caeel Caenorhabditis elegans MTWIKLASLALVVVLASAGISKNEDLECMFLGYPDLEYDGFDRTEVLTEKNFNRTVFAEDTKSVVFFNDVEEDDSELDQYECFLQLSAQIMTKRGYNFYTVNTTKEHRLRKQEEVEKGEDTIHVYKDGYKIEYNGVRDPETFVSWLMDIPDDPVTIINDEHDLEEFENMDDECVRIIGYFEPGSVALKEFEEAAEDFMGEIEFFAVVTSKWARKVGLKRVGEVQMRRPFEEDPLFAPTSADTEEEFEDWVEKNKEPVMQKLTLDNYFNLWRDPEEEERMILAFVDEETREGRAMKRLLDKIADENSEHAGTLEIILVDPDEFPLMVDVWEDMFGIDIEEGPQIGLIDISEKEGIWFDMSQVNLDDPKKHSDSNFEALQSWIDQILSGSISLDDDDDDEPEPPAPPPTPKGKKSRKEL pp2b_caeel Serine/threonine-protein phosphatase 2B catalytic subunit tax-6 Abnormal chemotaxis protein 6 Calmodulin-dependent calcineurin subunit A cna-1 C02F4.2 protein protein caeel Caenorhabditis elegans MASTSAGQNSAAKPDTTNTTTTASNNNRERERDLKQFTERFVKTVQFPVSERLTVDQVYDRRTGKPRHEVLRDHFIKEGRIEEEAAIRVIQECSSLFRNEKTMLEIEAPVTVCGDIHGQFYDLMKLFEVGGSPATTKYLFLGDYVDRGYFSIECVLYLWALKICYPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDVCMESFDALPLAALMNQQFLCVHGGLSPEIHTLEDIRRIDRFKEPPAFGPMCDLLWSDPLEDFGNERNSEQFSHNSVRGCSYFYSYAACCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVHILNICSDDELMAECDDTFEGGVGSARKEVIRHKIRAIGKMARAFSVLRHESESVLQLKGLNAGGKLPQGALSEGRTGLNAAYRIEQSVAAESGCDSGHLIQSFEEARRLDKINERMPPTMATPPAQSPSQSPIPSRQTTPQPPQNGPSNS cnb_1-calcium(2+)-1 2972307 N/A 2972309 unspecified role unspecified role bait bait 45ca region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2972310 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 2A csq_1-calcium(2+)-1 2972307 N/A 2972309 unspecified role unspecified role bait bait 45ca region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2972311 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 2A cnb_1-tax_6-1 2972308 N/A 2972312 unspecified role unspecified role bait bait N/A 2972310 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2B