UniProt UniProt http://www.uniprot.org wentz_hunter-2002-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wentz-Hunter K., Ueda J., Yue BY. u24184@uic.edu Human skeletal muscle cDNA Investigative ophthalmology & visual science 2002 imex curation Only protein-protein interactions wentz_hunter-2002-2 bovin-trabecular meshwork bovin trabecular meshwork Bovine trabecular_meshwork trabecular meshwork 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wentz-Hunter K., Ueda J., Yue BY. u24184@uic.edu Investigative ophthalmology & visual science 2002 imex curation Only protein-protein interactions wentz_hunter-2002-3 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wentz-Hunter K., Ueda J., Yue BY. u24184@uic.edu Investigative ophthalmology & visual science 2002 imex curation Only protein-protein interactions wentz_hunter-2002-4 human-trabecular meshwork Homo sapiens trabecular meshwork trabecular_meshwork trabecular meshwork anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wentz-Hunter K., Ueda J., Yue BY. u24184@uic.edu Investigative ophthalmology & visual science 2002 imex curation Only protein-protein interactions wentz_hunter-2002-5 human-trabecular meshwork Homo sapiens trabecular meshwork trabecular_meshwork trabecular meshwork fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Wentz-Hunter K., Ueda J., Yue BY. u24184@uic.edu Investigative ophthalmology & visual science 2002 imex curation Only protein-protein interactions wentz_hunter-2002-6 human-trabecular meshwork Homo sapiens trabecular meshwork trabecular_meshwork trabecular meshwork electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy immunostaining immunostaining Wentz-Hunter K., Ueda J., Yue BY. u24184@uic.edu Investigative ophthalmology & visual science 2002 imex curation Only protein-protein interactions myoc_human Myocilin Myocilin 55 kDa subunit Trabecular meshwork-induced glucocorticoid response protein MYOC GLC1A TIGR protein protein human Homo sapiens Human MRFFCARCCSFGPEMPAVQLLLLACLVWDVGARTAQLRKANDQSGRCQYTFSVASPNESSCPEQSQAMSVIHNLQRDSSTQRLDLEATKARLSSLESLLHQLTLDQAARPQETQEGLQRELGTLRRERDQLETQTRELETAYSNLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARLRRGQCPQTRDTARAVPPGSREVSTWNLDTLAFQELKSELTEVPASRILKESPSGYLRSGEGDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDIKLSKM mlrv_human Myosin regulatory light chain 2, ventricular/cardiac muscle isoform MYL2 Cardiac myosin light chain 2 MLC2 Myosin light chain 2, slow skeletal/ventricular muscle isoform Ventricular myosin light chain 2 protein protein human Homo sapiens Human MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD myl2-myoc-1 2875878 N/A 2875884 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Full length MYOC as bait did not give interacting clones N/A 2875885 unspecified role unspecified role prey prey physical association physical association false false false no figure myoc-myoc-1 2875878 N/A 2875884 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2875884 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Full length MYOC as bait did not give interacting clones 2875894 2875892 physical association physical association false false false no figure myoc-myl2-1 2875879 N/A 2875884 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Full length MYOC as bait did not give interacting clones N/A 2875885 unspecified role unspecified role prey prey physical association physical association false false false Table 1 myoc-myoc-2 2875879 N/A 2875884 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2875884 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Full length MYOC as bait did not give interacting clones 2875903 2875901 physical association physical association false false false Table 1 myoc-myl2-2 2875880 N/A 2875885 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes N/A 2875884 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false 1 myl2-myoc-2 2875880 N/A 2875885 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes N/A 2875884 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false 1 and 5B myoc-myl2-3 2875881 N/A 2875884 unspecified role unspecified role bait bait N/A 2875885 unspecified role unspecified role prey prey physical association physical association false false false 2A myoc-myl2-4 2875882 N/A 2875884 unspecified role unspecified role neutral component neutral component N/A 2875885 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3 colocalization on fibrillar structures myl2-myoc-3 2875883 N/A 2875884 unspecified role unspecified role neutral component neutral component N/A 2875885 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4