DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ strsser-2001-1 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Strässer K., Hurt E. DIP original experiment: DIP-265090X Nature 2001 IMEx Splicing factor Sub2p is required for nuclear mRNA export through its interaction with Yra1p. Strässer K., Hurt E. Only protein-protein interactions imex curation strsser-2001-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Strässer K., Hurt E. DIP original experiment: DIP-265088X Nature 2001 IMEx Splicing factor Sub2p is required for nuclear mRNA export through its interaction with Yra1p. Strässer K., Hurt E. Only protein-protein interactions imex curation strsser-2001-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Strässer K., Hurt E. DIP original experiment: DIP-265092X Nature 2001 IMEx Splicing factor Sub2p is required for nuclear mRNA export through its interaction with Yra1p. Strässer K., Hurt E. Only protein-protein interactions imex curation strsser-2001-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Strässer K., Hurt E. DIP original experiment: DIP-265089X Nature 2001 IMEx Splicing factor Sub2p is required for nuclear mRNA export through its interaction with Yra1p. Strässer K., Hurt E. Only protein-protein interactions imex curation strsser-2001-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Strässer K., Hurt E. DIP original experiment: DIP-265091X Nature 2001 IMEx Splicing factor Sub2p is required for nuclear mRNA export through its interaction with Yra1p. Strässer K., Hurt E. Only protein-protein interactions imex curation mex67_yeast mRNA export factor MEX67 MEX67 P2520 YPL169C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGFHNVGNINMMAQQQMQQNRIKISVRNWQNATMNDLINFISRNARVAVYDAHVEGPLVIGYVNSKAEAESLMKWNGVRFAGSNLKFELLDNNGASAGTSDTISFLRGVLLKRYDPQTKLLNLGALHSDPELIQKGVFSSISTQSKMFPAMMKLASTEKSLIVESVNLADNQLKDISAISTLAQTFPNLKNLCLANNQIFRFRSLEVWKNKFKDLRELLMTNNPITTDKLYRTEMLRLFPKLVVLDNVIVRDEQKLQTVYSLPMKIQQFFFENDALGQSSTDFATNFLNLWDNNREQLLNLYSPQSQFSVSVDSTIPPSTVTDSDQTPAFGYYMSSSRNISKVSSEKSIQQRLSIGQESINSIFKTLPKTKHHLQEQPNEYSMETISYPQINGFVITLHGFFEETGKPELESNKKTGKNNYQKNRRYNHGYNSTSNNKLSKKSFDRTWVIVPMNNSVIIASDLLTVRAYSTGAWKTASIAIAQPPQQQASVLPQVASMNPNITTPPQPQPSVVPGGMSIPGAPQGAMVMAPTLQLPPDVQSRLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF 6CE55EEC6FA40B40 yra1_yeast RNA annealing protein YRA1 YRA1 D9481.2 D9509.1 YDR381W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSANLDKSLDEIIGSNKAGSNRARVGGTRGNGPRRVGKQVGSQRRSLPNRRGPIRKNTRAPPNAVARVAKLLDTTREVKVNVEGLPRDIKQDAVREFFASQVGGVQRVLLSYNERGQSTGMANITFKNGELARRAVERFNGSPIDGGRSRLRLNLIVDPNQRPVKSLADRIKAMPQKGGNAPRPVKRGPNRKAAMAKSQNKPKREKPAKKSLEDLDKEMADYFEKK 480B5B6DC0D14BE9 sub2_yeast ATP-dependent RNA helicase SUB2 SUB2 Suppressor of BRR1 protein 2 YDL084W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSHEGEEDLLEYSDNEQEIQIDASKAAEAGETGAATSATEGDNNNNTAAGDKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVAVVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAELLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLDDLEFNQVIIFVKSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVSSKEDEEVLAKIQERFDVKIAEFPEEGIDPSTYLNN AB3605A8C38A560C thoc4_human THO complex subunit 4 ALYREF ALY Ally of AML-1 and LEF-1 Aly/REF export factor BEF THOC4 Transcriptional coactivator Aly/REF bZIP-enhancing factor BEF protein protein human Homo sapiens Human MADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS yra1p-mex67p-1 3135703 N/A 3135708 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3135709 unspecified role unspecified role bait bait 1-76 Binding region 1-76 Binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 184-226 Binding region 184-226 Binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false sub2p-yra1p-1 3135704 N/A 3135710 unspecified role unspecified role bait bait ProtA Tag ProtA Tag protein a tag protein a tag protein A protein A predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3135709 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false alyref-sub2p-1 3135705 N/A 3135710 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3135711 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false yra1p-sub2p-1 3135706 N/A 3135710 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3135709 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 1-76 Binding region 1-76 Binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 184-226 Binding region 184-226 Binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false alyref-mex67p-1 3135707 N/A 3135708 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3135711 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false