DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mccarthy-2000-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined McCarthy AA., Haebel PW., Törrönen A., Rybin V., Baker EN., Metcalf P. DIP original experiment: DIP-262983X Nature structural biology 2000 IMEx Crystal structure of the protein disulfide bond isomerase, DsbC, from Escherichia coli. McCarthy AA., Haebel PW., Törrönen A., Rybin V., Baker EN., Metcalf P. Only protein-protein interactions imex curation dsbc_ecoli Thiol:disulfide interchange protein DsbC dsbC xprA b2893 JW2861 protein protein ecoli Escherichia coli (strain K12) MKKGFMLFTLLAAFSGFAQADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK dsbc-1 3135253 N/A 3135254 unspecified role unspecified role unspecified role unspecified role 21-236 binding region 21-236 binding region binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false