DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wiesmann-1999-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wiesmann C., Ultsch MH., Bass SH., de Vos AM. DIP original experiment: DIP-265113X Nature 1999 IMEx Crystal structure of nerve growth factor in complex with the ligand-binding domain of the TrkA receptor. Wiesmann C., Ultsch MH., Bass SH., de Vos AM. Only protein-protein interactions imex curation wiesmann-1999-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wiesmann C., Ultsch MH., Bass SH., de Vos AM. DIP original experiment: DIP-265114X Nature 1999 IMEx Crystal structure of nerve growth factor in complex with the ligand-binding domain of the TrkA receptor. Wiesmann C., Ultsch MH., Bass SH., de Vos AM. Only protein-protein interactions imex curation ntrk1_human High affinity nerve growth factor receptor NTRK1 TRK Neurotrophic tyrosine kinase receptor type 1 TRK1-transforming tyrosine kinase protein p140-TrkA MTC TRKA Tropomyosin-related kinase A Tyrosine kinase receptor Tyrosine kinase receptor A gp140trk protein protein human Homo sapiens Human MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG ngf_human Beta-nerve growth factor NGF NGFB protein protein human Homo sapiens Human MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA ngf-ntrk1-1 3135184 N/A 3135186 unspecified role unspecified role unspecified role unspecified role 282-383 Binding region 282-383 Binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3135187 unspecified role unspecified role unspecified role unspecified role 122-241 Binding region 122-241 Binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ngf-ntrk1-2 3135185 N/A 3135186 unspecified role unspecified role unspecified role unspecified role 282-383 Binding region 282-383 Binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3135187 unspecified role unspecified role unspecified role unspecified role 122-241 Binding region 122-241 Binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false