DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ko-1999-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ko TP., Liao CC., Ku WY., Chak KF., Yuan HS. DIP original experiment: DIP-263245X Structure (London, England : 1993) 1999 IMEx The crystal structure of the DNase domain of colicin E7 in complex with its inhibitor Im7 protein. Ko TP., Liao CC., Ku WY., Chak KF., Yuan HS. Only protein-protein interactions imex curation ko-1999-2 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom weight by staining molecular weight estimation by staining weight by staining Ko TP., Liao CC., Ku WY., Chak KF., Yuan HS. DIP original experiment: DIP-263246X Structure (London, England : 1993) 1999 IMEx The crystal structure of the DNase domain of colicin E7 in complex with its inhibitor Im7 protein. Ko TP., Liao CC., Ku WY., Chak KF., Yuan HS. Only protein-protein interactions imex curation ko-1999-3 ecolx Escherichia coli pull down pull down weight by staining molecular weight estimation by staining weight by staining Ko TP., Liao CC., Ku WY., Chak KF., Yuan HS. DIP original experiment: DIP-263247X Structure (London, England : 1993) 1999 IMEx The crystal structure of the DNase domain of colicin E7 in complex with its inhibitor Im7 protein. Ko TP., Liao CC., Ku WY., Chak KF., Yuan HS. Only protein-protein interactions imex curation cea7_ecolx Colicin-E7 colE7 cea protein protein ecolx Escherichia coli MSGGDGRGHNSGAHNTGGNINGGPTGLGGNGGASDGSGWSSENNPWGGGSGSGVHWGGGSGHGNGGGNSNSGGGSNSSVAAPMAFGFPALAAPGAGTLGISVSGEALSAAIADIFAALKGPFKFSAWGIALYGILPSEIAKDDPNMMSKIVTSLPAETVTNVQVSTLPLDQATVSVTKRVTDVVKDTRQHIAVVAGVPMSVPVVNAKPTRTPGVFHASFPGVPSLTVSTVKGLPVSTTLPRGITEDKGRTAVPAGFTFGGGSHEAVIRFPKESGQKPVYVSVTDVLTPAQVKQRQDEEKRLQQEWNDAHPVEVAERNYEQARAELNQANKDVARNQERQAKAVQVYNSRKSELDAANKTLADAKAEIKQFERFAREPMAAGHRMWQMAGLKAQRAQTDVNNKKAAFDAAAKEKSDADVALSSALERRKQKENKEKDAKAKLDKESKRNKPGKATGKGKPVNNKWLNNAGKDLGSPVPDRIANKLRDKEFKSFDDFRKKFWEEVSKDPELSKQFSRNNNDRMKVGKAPKTRTQDVSGKRTSFELHHEKPISQNGGVYDMDNISVVTPKRHIDIHRGK imm7_ecolx Colicin-E7 immunity protein imm ceiE7 ImmE7 Microcin-E7 immunity protein protein protein ecolx Escherichia coli MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG cole7-imm-3 3135097 N/A 3135100 unspecified role unspecified role unspecified role unspecified role 371-576 binding region 371-576 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3135101 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cole7-imm-4 3135098 N/A 3135100 unspecified role unspecified role unspecified role unspecified role 371-576 binding region 371-576 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3135101 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cole7-imm-5 3135099 N/A 3135100 unspecified role unspecified role bait bait 371-576 binding region 371-576 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3135101 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false