DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ nicolet-1999-1 desvh Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nicolet Y., Piras C., Legrand P., Hatchikian CE., Fontecilla-Camps JC. DIP original experiment: DIP-263241X Structure (London, England : 1993) 1999 IMEx Desulfovibrio desulfuricans iron hydrogenase: the structure shows unusual coordination to an active site Fe binuclear center. Nicolet Y., Piras C., Legrand P., Hatchikian CE., Fontecilla-Camps JC. Only protein-protein interactions imex curation phfs_desvh Periplasmic [Fe] hydrogenase small subunit hydB Fe hydrogenlyase small chain DVU_1770 protein protein desvh Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) MQIASITRRGFLKVACVTTGAALIGIRMTGKAVAAVKQIKDYMLDRINGVYGADAKFPVRASQDNTQVKALYKSYLEKPLGHKSHDLLHTHWFDKSKGVKELTTAGKLPNPRASEFEGPYPYE phfl_desvh Periplasmic [Fe] hydrogenase large subunit hydA Fe hydrogenlyase DVU_1769 protein protein desvh Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) MSRTVMERIEYEMHTPDPKADPDKLHFVQIDEAKCIGCDTCSQYCPTAAIFGEMGEPHSIPHIEACINCGQCLTHCPENAIYEAQSWVPEVEKKLKDGKVKCIAMPAPAVRYALGDAFGMPVGSVTTGKMLAALQKLGFAHCWDTEFTADVTIWEEGSEFVERLTKKSDMPLPQFTSCCPGWQKYAETYYPELLPHFSTCKSPIGMNGALAKTYGAERMKYDPKQVYTVSIMPCIAKKYEGLRPELKSSGMRDIDATLTTRELAYMIKKAGIDFAKLPDGKRDSLMGESTGGATIFGVTGGVMEAALRFAYEAVTGKKPDSWDFKAVRGLDGIKEATVNVGGTDVKVAVVHGAKRFKQVCDDVKAGKSPYHFIEYMACPGGCVCGGGQPVMPGVLEAMDRTTTRLYAGLKKRLAMASANKA hyda-hydb-3 3135091 N/A 3135092 unspecified role unspecified role unspecified role unspecified role desvh Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) N/A 3135093 unspecified role unspecified role unspecified role unspecified role desvh Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) direct interaction direct interaction false false false