IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ klein-2015-1 ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Klein H., Abu-Arish A., Trinh NT., Luo Y., Wiseman PW., Hanrahan JW., Brochiero E., Sauvé R., Klein H., Abu-Arish A., Trinh NT., Luo Y., Wiseman PW., Hanrahan JW., Brochiero E., Sauvé R. The interaction of AMPK-alpha1 (Prkaa1) with CFTR has not been entered as the species of the Prkaa1 construct cannot be confirmed; Hallows et al., Ref 26 -does not contain the info, and previous work by Hallows et al. 2000, refers to a Rattine protein, however the stated residue mapping in Table 1 (Arg407 and Pro550) does not correspond to the Rat or Human/Mouse protein. Similarly the interaction between CK2 and CFTR has not been entered as the identity and origin of CK2-beta are not known;there is no residue Arg234 (Table 1) as the Rat/Human/Mouse proteins are only 215 aas in length. Results from Table 1; it has been assumed that the Bait Plasmids are given at the top of the table, as text clearly states that:- "the KCa3.1 C-terminus BAIT (N300-A400) can physically interact with the C-terminus of CFTR (T1387-L1480)". CFTR, AMPK-gamma1 and KCa3.1(KCNN4) have been determined to be of Human origin due to residue mapping and sequence length as given in Bacteriophage two-hybrid analysis -Methods section. remy.sauve@umontreal.ca PloS one 2015 imex curation Only protein-protein interactions klein-2015-2 human-cfbe Homo sapiens cfbe cfbe-cystic fibrosis bronchial epithelial cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Klein H., Abu-Arish A., Trinh NT., Luo Y., Wiseman PW., Hanrahan JW., Brochiero E., Sauvé R., Klein H., Abu-Arish A., Trinh NT., Luo Y., Wiseman PW., Hanrahan JW., Brochiero E., Sauvé R. CFTR, AMPK-gamma1 and KCa3.1(KCNN4) have been determined to be of Human origin due to residue mapping and sequence length as given in Bacteriophage two-hybrid analysis -Methods section. remy.sauve@umontreal.ca PloS one 2015 imex curation Only protein-protein interactions klein-2015-3 human-cfbe Homo sapiens cfbe cfbe-cystic fibrosis bronchial epithelial cell line confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Klein H., Abu-Arish A., Trinh NT., Luo Y., Wiseman PW., Hanrahan JW., Brochiero E., Sauvé R., Klein H., Abu-Arish A., Trinh NT., Luo Y., Wiseman PW., Hanrahan JW., Brochiero E., Sauvé R. CFTR, AMPK-gamma1 and KCa3.1(KCNN4) have been determined to be of Human origin due to residue mapping and sequence length as given in Bacteriophage two-hybrid analysis -Methods section. remy.sauve@umontreal.ca PloS one 2015 imex curation Only protein-protein interactions klein-2015-4 human-cfbe Homo sapiens cfbe cfbe-cystic fibrosis bronchial epithelial cell line fcs fluorescence correlation spectroscopy FCS FCS fcs predetermined predetermined participant predetermined Klein H., Abu-Arish A., Trinh NT., Luo Y., Wiseman PW., Hanrahan JW., Brochiero E., Sauvé R., Klein H., Abu-Arish A., Trinh NT., Luo Y., Wiseman PW., Hanrahan JW., Brochiero E., Sauvé R. CFTR, AMPK-gamma1 and KCa3.1(KCNN4) have been determined to be of Human origin due to residue mapping and sequence length as given in Bacteriophage two-hybrid analysis -Methods section. remy.sauve@umontreal.ca PloS one 2015 imex curation Only protein-protein interactions cftr_human Cystic fibrosis transmembrane conductance regulator CFTR ABCC7 cAMP-dependent chloride channel ATP-binding cassette sub-family C member 7 Channel conductance-controlling ATPase protein protein human Homo sapiens Human MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLINALRRCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIVLALFQAGLGRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQTELKLTRKAAYVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAVTRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNSILNPINSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDLKECFFDDMESIPAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRNNSYAVIITSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTLKAGGILNRFSKDIAILDDLLPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATVPVIVAFIMLRAYFLQTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIMSTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKKDDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL kcnn4_human Intermediate conductance calcium-activated potassium channel protein 4 KCNN4 IK1 IKCA1 KCA4 SK4 KCa4 KCa3.1 IKCa1 Putative Gardos channel protein protein human Homo sapiens Human MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFLVKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPAPVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDTLWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQSK p54619-1 5'-AMP-activated protein kinase subunit gamma-1 PRKAG1 protein protein human Homo sapiens Human METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP kcnn4-cftr-2 2867947 N/A 2867951 unspecified role unspecified role prey prey ATP_binding_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2867952 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 2867959 2867956 2867960 2867957 physical association physical association false false false Table 1i kcnn4-prkag1-1 2867947 N/A 2867953 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2867952 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 2867966 2867963 2867967 2867964 physical association physical association false false false Table 1iv kcnn4-prkag1-2 2867947 N/A 2867953 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2867951 unspecified role unspecified role prey prey ATP_binding_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 2867972 2867970 physical association physical association false false false Table 1v kcnn4-cftr-4 2867948 N/A 2867951 unspecified role unspecified role prey prey P13569:p.Phe508del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false N/A 2867952 unspecified role unspecified role bait bait physical association physical association false false false Fig 1 A/C In cells expressing CFTR having the Delta-508 CFTR Cystic fibrosis mutation, only an immature form of CFTR, probably with altered glycosylation, is detected. kcnn4-cftr-1 2867948 N/A 2867951 unspecified role unspecified role bait bait P13569:p.Phe508del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false N/A 2867952 unspecified role unspecified role prey prey physical association physical association false false false Fig 1 B/D cftr-kcnn4-2 2867949 N/A 2867951 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867952 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 3, Supp fig 1 Ca2+ ions (CHEBI:29108) cftr-kcnn4-1 2867950 N/A 2867951 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867952 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3C, 4 Ca2+ ions (CHEBI:29108)