HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html del-2016-1 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Del Giudice MG., Döhmer PH., Spera JM., Laporte FT., Marchesini MI., Czibener C., Ugalde JE. jugalde@iibintech.com.ar The Journal of biological chemistry 2016 imex curation Only protein-protein interactions imex curation del-2016-3 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Del Giudice MG., Döhmer PH., Spera JM., Laporte FT., Marchesini MI., Czibener C., Ugalde JE. jugalde@iibintech.com.ar The Journal of biological chemistry 2016 imex curation Only protein-protein interactions imex curation del-2016-2 ecoli Escherichia coli (strain K12) adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Del Giudice MG., Döhmer PH., Spera JM., Laporte FT., Marchesini MI., Czibener C., Ugalde JE. jugalde@iibintech.com.ar The Journal of biological chemistry 2016 imex curation Only protein-protein interactions imex curation q2ys16_brua2 BAB1_1492 protein protein brua2 brua2 MMPVIRLNDATFADLSVLKTWYGTKTPSETIDRIVREAMEQLDMERDDAAEEVTVTTSDGAMHFDAAPGLAFTKPLAASIDGKALHSPCWSALLLTMIAQVKTKGLSGDKLVRELAIPAKVERYDEEGFKFRPDLGISVQGQSASDCWKEVERLSKKWAIPVSVKFWWKQNPKAQYPGKTGILRSGPASA q2ykk5_brua2 BAB2_0654 protein protein brua2 brua2 MDAMLARNIIVMPVELGPWRAALDKEDGECNYLDSDFEAIAKEALRGLDLGVYFHPVLTGIGQGATIAYAAASDSPDATIAGAVSLDPTPARTRLPSCTEKAEAIKGPDGGFTYSVNAALPAPALLISPPGSPVNNPVEARRKNIAVLQTAPDFSARMKMAVDNVVAMADQDAKNEALPIIDLPAKGGNADMVAVFYSGDGGWRDIDKSIGEWLQAHGVHVIGVDSLRYFWSERTPEEIANDTTAMIKKADPTGKLPVAVLGYSFGADTFPFAWKYLDPSIQDRTRMVGLLGVETTTTFQVSIEGWLGMNGDKDVVPAIASIPLDRVVCVYGQEEDDTACTADELKGMDTMKLPGGHHFDENYEPIAAALLDKMRSRAGLPPRPAR q2yld2_brua2 BAB2_0123 protein protein brua2 brua2 MSLLLANVLSTLMALASLAALIVVGRKANETIRLGKVLALRVAAASNGLERAVKAIRNERTDLTDASAKLDARLAETQRVRREMDEAIEELNRLRKALSRDMRQARILAETPPPRQEKTPSAAEQPLPADKNALPVFVRRAVKKATVELAGQA virb8_brua2 Type IV secretion system protein virB8 virB8 BAB2_0061 protein protein brua2 brua2 MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRAWKIAGAFGTITVLLGIGIAGMLPLKQHVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWYTLQKDYETVGMLSSPSEGQSYASQFQGDKALDKQYGSNVRTSVTIVSIVPNGKGIGTVRFAKTTKRTNETGDGETTHWIATIGYQYVNPSLMSESARLTNPLGFNVTSYRVDPEMGVVQ virb5_brua2 Type IV secretion system protein virB5 virB5 BAB2_0064 protein protein brua2 brua2 MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKFAQQIEQLKQQFEQQKMQFDALTGNRGLGDILRDPTLRSYLPHNWRDLYEAVMSGGYLAAAGETANLLRKSQVYDPCASISDKDQRIACEAKVVKPVQDKVMTSKAYDATDKRLQEIESLMQEINKTGDPKAIAELQGRIESENAMIQNEDTRLRLYQQMAEAQDKLLDERQHELDAKDNARRGYPQPKALEAAY virj-sepa-1 2843386 N/A 2843389 unspecified role unspecified role prey prey purified purified c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 2843390 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 4A virj-bpe123-1 2843386 N/A 2843391 unspecified role unspecified role prey prey purified purified c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 2843390 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 4A virj-virb5-virb8-1 2843387 N/A 2843392 unspecified role unspecified role prey prey N/A 2843393 unspecified role unspecified role prey prey N/A 2843390 unspecified role unspecified role bait bait c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false 5 sepa-virb5-virb8-1 2843387 N/A 2843392 unspecified role unspecified role prey prey N/A 2843393 unspecified role unspecified role prey prey N/A 2843389 unspecified role unspecified role bait bait c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false 5 virj-sepa-2 2843388 N/A 2843389 unspecified role unspecified role bait bait N/A 2843390 unspecified role unspecified role prey prey physical association physical association false false false 4B