IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ dyer-2016-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Dyer DP., Salanga CL., Johns SC., Valdambrini E., Fuster MM., Milner CM., Day AJ., Handel TM. Stoichiometry and Kd values are taken from Table 1. Values of Chi-squared that are less than 10 or less than 10% of Rmax are stated to indicate a good fit to the 1:1 Langmuir model. All chemokines used are of Human origin, as confirmed by the authors thandel@ucsd.edu,anthony.day@manchester.ac.uk,caroline.milner@manchester.ac.uk The Journal of biological chemistry 2016 Only protein-protein interactions imex curation imex curation dyer-2016-2 in vitro In vitro solid phase assay solid phase assay tag visualisation tag visualisation Dyer DP., Salanga CL., Johns SC., Valdambrini E., Fuster MM., Milner CM., Day AJ., Handel TM. All chemokines used are of Human origin, as confirmed by the authors thandel@ucsd.edu,anthony.day@manchester.ac.uk,caroline.milner@manchester.ac.uk The Journal of biological chemistry 2016 Only protein-protein interactions imex curation imex curation o14625-pro_0000005106 C-X-C motif chemokine 11 Beta-R1 H174 Interferon gamma-inducible protein 9 Interferon-inducible T-cell alpha chemoattractant Small-inducible cytokine B11 CXCL11 ITAC SCYB11 SCYB9B protein protein human Homo sapiens Human FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF 22 94 tsg6_human Tumor necrosis factor-inducible gene 6 protein TSG6 TNFAIP6 Hyaluronate-binding protein TNF-stimulated gene 6 protein Tumor necrosis factor alpha-induced protein 6 protein protein human Homo sapiens Human MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFTDPKQIFKSPGFPNEYEDNQICYWHIRLKYGQRIHLSFLDFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL p48061-pro_0000005109 Stromal cell-derived factor 1 C-X-C motif chemokine 12 Intercrine reduced in hepatomas Pre-B cell growth-stimulating factor CXCL12 SDF1 SDF1A SDF1B protein protein human Homo sapiens Human KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM 22 93 p13500-pro_0000005146 C-C motif chemokine 2 HC11 Monocyte chemoattractant protein 1 Monocyte chemotactic and activating factor Monocyte chemotactic protein 1 Monocyte secretory protein JE Small-inducible cytokine A2 CCL2 MCP1 SCYA2 protein protein human Homo sapiens Human QPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT 24 99 p80098-pro_0000005183 C-C motif chemokine 7 CCL7 MCP3 SCYA6 SCYA7 Monocyte chemoattractant protein 3 Monocyte chemotactic protein 3 NC28 Small-inducible cytokine A7 protein protein human Homo sapiens Human QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL 24 99 q99731-pro_0000005214 C-C motif chemokine 19 CCL19 ELC MIP3B SCYA19 Beta-chemokine exodus-3 CK beta-11 Epstein-Barr virus-induced molecule 1 ligand chemokine Macrophage inflammatory protein 3 beta Small-inducible cytokine A19 protein protein human Homo sapiens Human GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS 22 98 o00585-pro_0000005220 C-C motif chemokine 21 CCL21 SCYA21 6Ckine Beta-chemokine exodus-2 Secondary lymphoid-tissue chemokine Small-inducible cytokine A21 UNQ784/PRO1600 protein protein human Homo sapiens Human SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP 24 134 pro_0000005239 C-C motif chemokine 27 CCL27 ILC SCYA27 protein protein human Homo sapiens Human FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG p13501-pro_0000005175 C-C motif chemokine 5 Eosinophil chemotactic cytokine SIS-delta Small-inducible cytokine A5 T cell-specific protein P228 T-cell-specific protein RANTES EoCP D17S136E SCYA5 CCL5 protein protein human Homo sapiens Human SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS 24 91 plf4_human Platelet factor 4 PF4 CXCL4 SCYB4 C-X-C motif chemokine 4 Oncostatin-A Iroplact protein protein human Homo sapiens Human MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES heparin Heparin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tnfaip6-cxcl11-2 1933988 N/A 1933990 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 1933991 unspecified role unspecified role bait bait link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1933988 1B tnfaip6-cxcl12-1 1933988 N/A 1933992 unspecified role unspecified role prey prey P48061-PRO_0000005109:p.[Lys24_His25delinsSerSer;Lys27Ser] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1933991 unspecified role unspecified role bait bait link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1933988 1 C/D, 2E tnfaip6-ccl2-1 1933988 N/A 1933993 unspecified role unspecified role prey prey P13500-PRO_0000005146:p.Arg18_Lys19delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1933991 unspecified role unspecified role bait bait link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 1933988 1E, 2A tnfaip6-ccl7-1 1933988 N/A 1933994 unspecified role unspecified role prey prey P80098-PRO_0000005183:p.[Lys18_Lys19delinsAlaAla;Lys22Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1933991 unspecified role unspecified role bait bait link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 1933988 1F, 2D There was a weak interaction with the CCL7 K18A/K19A/K22A mutant; there was insufficient signal to calculate a Kd value. tnfaip6-ccl19-1 1933988 N/A 1933995 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1933991 unspecified role unspecified role bait bait link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 1933988 1G tnfaip6-ccl21-1 1933988 N/A 1933996 unspecified role unspecified role prey prey c_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1933991 unspecified role unspecified role bait bait link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1933988 1H, 2C tnfaip6-ccl27-1 1933988 N/A 1933997 unspecified role unspecified role prey prey Q9Y4X3-PRO_0000005239:p.Lys25Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1933991 unspecified role unspecified role bait bait link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 1933988 1 I/J, 2F tnfaip6-ccl5-1 1933988 N/A 1933998 unspecified role unspecified role prey prey P13501-PRO_0000005175:p.[Arg44_Lys45delinsAlaAla;Arg47Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1933991 unspecified role unspecified role bait bait link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2B tnfaip6-pf4-1 1933988 N/A 1933999 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1933991 unspecified role unspecified role bait bait link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 1934043 1934041 direct interaction direct interaction false false false 1933988 1A heparin-tnfaip6-1 1933988 N/A 1934000 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1933991 unspecified role unspecified role prey prey link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 1933988 7 cxcl11-heparin-1 1933989 N/A 1933990 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 1934000 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 4A ccl2-heparin-1 1933989 N/A 1933993 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 1934000 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 4A-2 tnfaip6-cxcl11-3 1933989 N/A 1934000 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1933990 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 1933991 competitor competitor competitor prey prey P98066:p.[Lys55Ala;Lys69Ala;Lys76Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1933989 4B ccl2-heparin-2 1933989 N/A 1934000 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1933993 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 1933991 competitor competitor competitor prey prey P98066:p.[Lys55Ala;Lys69Ala;Lys76Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1933989 4B-2 ccl19-heparin-2 1933989 N/A 1934000 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1933995 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 1933991 competitor competitor competitor prey prey P98066:p.[Lys55Ala;Lys69Ala;Lys76Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1933989 4C ccl19-heparin-1 1933989 N/A 1933991 competitor competitor competitor prey prey link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P98066:p.[Lys55Ala;Lys69Ala;Lys76Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1934000 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1933994 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1933989 4C-2