IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hessner-2015-3 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Hermann.Pavenstaedt@ukmuenster.de,rescher@uni-muenster.de Scientific reports 2015 imex curation Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U., Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Only protein-protein interactions hessner-2015-2 human-UKRV-Mel-4 UKRV-Mel-4 Melanoma cell line Human ukrv-mel-4 UKRV-Mel-4 Melanoma cell line pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Hermann.Pavenstaedt@ukmuenster.de,rescher@uni-muenster.de Scientific reports 2015 imex curation Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U., Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Only protein-protein interactions hessner-2015-1 human-UKRV-Mel-4 UKRV-Mel-4 Melanoma cell line Human ukrv-mel-4 UKRV-Mel-4 Melanoma cell line confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Hermann.Pavenstaedt@ukmuenster.de,rescher@uni-muenster.de Scientific reports 2015 imex curation Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U., Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Only protein-protein interactions hessner-2015-4 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Hermann.Pavenstaedt@ukmuenster.de,rescher@uni-muenster.de Scientific reports 2015 imex curation Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U., Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Only protein-protein interactions s10aa_human Protein S100-A10 S100 calcium-binding protein A10 Calpactin-1 light chain Calpactin I light chain p10 protein p11 Cellular ligand of annexin II S100A10 ANX2LG CAL1L CLP11 protein protein human Homo sapiens Human MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK anxa2_human Annexin A2 ANXA2 ANX2 ANX2L4 CAL1H LPC2D Annexin-2 Annexin II Lipocortin II Calpactin I heavy chain Chromobindin-8 p36 Protein I Placental anticoagulant protein IV Calpactin-1 heavy chain protein protein human Homo sapiens Human MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD ccr10_human C-C chemokine receptor type 10 CCR10 GPR2 G-protein coupled receptor 2 protein protein human Homo sapiens Human MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLTVAALGLAGNGLVLATHLAARRAARSPTSAHLLQLALADLLLALTLPFAAAGALQGWSLGSATCRTISGLYSASFHAGFLFLACISADRYVAIARALPAGPRPSTPGRAHLVSVIVWLLSLLLALPALLFSQDGQREGQRRCRLIFPEGLTQTVKGASAVAQVALGFALPLGVMVACYALLGRTLLAARGPERRRALRVVVALVAAFVVLQLPYSLALLLDTADLLAARERSCPASKRKDVALLVTSGLALARCGLNPVLYAFLGLRFRQDLRRLLRGGSCPSGPQPRRGCPRRPRLSSCSAPTETHSLSWDN anxa2_pig Annexin A2 ANXA2 ANX2 Annexin-2 Annexin II Lipocortin II Calpactin I heavy chain Chromobindin-8 p36 Protein I Placental anticoagulant protein IV Calpactin-1 heavy chain protein protein pig Sus scrofa (Pig) Pig MSTVHEILCKLSLEGDHSTPASAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERYKSYSPYDMLESIKKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIXIMVSRSEVDMLKIRSEFKRKYGKSLYNYIQQDTKGDYQKALLYLCGGDD mint Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity s10aa_pig Protein S100-A10 S100A10 Calpactin I light chain Calpactin-1 light chain Cellular ligand of annexin II S100 calcium-binding protein A10 p10 protein p11 protein protein pig Sus scrofa (Pig) Pig MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGK actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF anxa2-ccr10-2 2867888 N/A 2867892 unspecified role unspecified role prey prey human-UKRV-Mel-4 UKRV-Mel-4 Melanoma cell line Human ukrv-mel-4 UKRV-Mel-4 Melanoma cell line N/A 2867893 unspecified role unspecified role prey prey human-UKRV-Mel-4 UKRV-Mel-4 Melanoma cell line Human ukrv-mel-4 UKRV-Mel-4 Melanoma cell line N/A 2867894 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) association association false false false 3A ccr10-anxa2-2 2867888 N/A 2867895 unspecified role unspecified role prey prey pig-intestinal mucosa pig Pig intestinal mucosa N/A 2867896 unspecified role unspecified role prey prey pig-intestinal mucosa pig Pig intestinal mucosa N/A 2867894 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) association association false false false 3B-2 ccr10-anxa2-3 2867888 N/A 2867892 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2867894 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3B, 4 ccr10-s100a10-2 2867888 N/A 2867892 unspecified role unspecified role prey prey P60903:p.Cys83Gln mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P60903:p.Cys83Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2867894 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 2867925 2867922 direct interaction direct interaction false false false 2867888 5B actb-ccr10-2 2867889 N/A 2867897 unspecified role unspecified role neutral component neutral component N/A 2867894 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 1B-3 S100A10 protein actb-ccr10-3 2867889 N/A 2867893 unspecified role unspecified role neutral component neutral component N/A 2867894 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 1B-2 S100A10 protein anxa2-ccr10-1 2867889 N/A 2867892 unspecified role unspecified role neutral component neutral component N/A 2867894 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 1B-1 actb-ccr10-1 2867890 N/A 2867897 unspecified role unspecified role neutral component neutral component N/A 2867894 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1A ccr10-s100a10-1 2867891 N/A 2867892 unspecified role unspecified role prey prey P60903:p.Cys83Gln mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P60903:p.Cys83Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2867894 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 2867946 2867943 direct interaction direct interaction false false false 2867891 5 A+C, Supp fig 4