HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html singh-2014-2 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Singh B., Su YC., Al-Jubair T., Mukherjee O., Hallström T., Mörgelin M., Blom AM., Riesbeck K. No Taxonomic ID can be found for H. influenzae type b strain RM804, so UniProt entry Q4KTX9 (Q4KTX9_HAEIF) has been used for HSF. Vitronectin was determined to be of Human origin from previous work of the first author - Singh at al., 2010. kristian.riesbeck@med.lu.se Infection and immunity 2014 imex curation Only protein-protein interactions imex curation singh-2014-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Singh B., Su YC., Al-Jubair T., Mukherjee O., Hallström T., Mörgelin M., Blom AM., Riesbeck K. No Taxonomic ID can be found for H. influenzae type b strain RM804, so UniProt entry Q4KTX9 (Q4KTX9_HAEIF) has been used for HSF. Vitronectin was determined to be of Human origin from previous work of the first author - Singh at al., 2010. kristian.riesbeck@med.lu.se Infection and immunity 2014 imex curation Only protein-protein interactions imex curation singh-2014-7 in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Singh B., Su YC., Al-Jubair T., Mukherjee O., Hallström T., Mörgelin M., Blom AM., Riesbeck K. No Taxonomic ID can be found for H. influenzae type b strain RM804, so UniProt entry Q4KTX9 (Q4KTX9_HAEIF) has been used for HSF. Vitronectin was determined to be of Human origin from previous work of the first author - Singh at al., 2010. kristian.riesbeck@med.lu.se Infection and immunity 2014 imex curation Only protein-protein interactions imex curation vtnc_human Vitronectin VTN Serum-spreading factor V75 S-protein protein protein human Homo sapiens Human MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL q4ktx9_haeif protein protein haeif Haemophilus influenzae MNKIFNVIWNVMTQTWVVVSELTRTHTKRASATVETAVLATLLFATVQANATDEDEELDPVVRTAPVLSFHSDKEGTGEKEVTENSNWGIYFDNKGVLKAGAITLKAGDNLKIKQNTDESTNASSFTYSLKKDLTDLTSVATEKLSFGANGDKVDITSDANGLKLAKTGNGNVHLNGLDSTLPDAVTNTGVLSSSSFTPNDVEKTRAATVKDVLNAGWNIKGAKTAGGNVESVDLVSAYNNVEFITGDKNTLDVVLTAKENGKTTEVKFTPKTSVIKEKDGKLFTGKENNDTNKVTSNTATDNTDEGNGLVTAKAVIDAVNKAGWRVKTTTANGQNGDFATVASGTNVTFESGDGTTASVTKDTNGNGITVKYDAKVGDGLKFDSDKKIVADTTALTVTGGKVAEIAKEDDKKKLVNAGDLVTALGNLSWKAKAEADTDGALEGISKDQEVKAGETVTFKAGKNLKVKQDGANFTYSLQDALTGLTSITLGGTTNGGNDAKTVINKDGLTITPAGNGGTTGTNTISVTKDGIKAGNKAITNVASGLRAYDDANFDVLNNSATDLNRHVEDAYKGLLNLNEKNANKQPLVTDSTAATVGDLRKLGWVVSTKNGTKEESNQVKQADEVLFTGAGAATVTSKSENGKHTITVSVAETKADSGLEKDGDTIKLKVDNQNTDNVLTVGNNGTAVTKGGFETVKTGATDADRGKVTVKDATANDADKKVATVKDVATAINSAATFVKTENLTTSIDEDNPTDNGKDDALKAGDTLTFKAGKNLKVKRDGKNITFDLAKNLEVKTAKVSDTLTIGGNTPTGGTTATPKVNITSTADGLNFAKETADASGSKNVYLKGIATTLTEPSAGAKSSHVDLNVDATKKSNAASIEDVLRAGWNIQGNGNNVDYVATYDTVNFTDDSTGTTTVTVTQKADGKGADVKIGAKTSVIKDHNGKLFTGKGLKDANNGATVSEDDGKDTGTGLVTAKTVIDAVNKSGWRVTGEGATAETGATAVNAGNAETVTSGTSVNFKNGNATTATVSKDNGNINVKYDVNVGDGLKIGDDKKIVADTTTLTVTGGKVSVPAGANSVNNNKKLVNAEGLATALNNLSWTAKADKYADGESEGETDQEVKAGDKVTFKAGKNLKVKQSEKDFTYSLQDTLTGLTSITLGGTANGRNDTGTVINKDGLTITLANGAAAGTDASNGNTISVTKDGISAGNKEITNVKSALKTYKDTQNTAGATQPAANTAEVAKQDLVDLTKPATGAAGNGADAKAPDTTAATVGDLRGLGWVLSAKKTADETQDKEFHAAVKNANEVEFVGKNGATVSAKTDNNGKHTVTIDVAEAKVGDGLEKDTDGKIKLKVDNTDGNNLLTVDATKGASVAKGEFNAVTTDATTAQGTNANERGKVVVKGSNGATATETDKKKVATVGDVAKAINDAATFVKVENDDSATIDDSPTDDGANDALKAGDTLTLKAGKNLKVKRDGKNITFALANDLSVKSATVSDKLSLGTNGNKVNITSDTKGLNFAKDSKTGDDANIHLNGIASTLTDTLLNSGATTNLGGNGITDNEKKRAASVKDVLNAGWNVRGVKPASANNQVENIDFVATYDTVDFVSGDKDTTSVTVESKDNGKRTEVKIGAKTSVIKDHNGKLFTGKELKDANNNGVTVTETDGKDEGNGLVTAKAVIDAVNKAGWRVKTTGANGQNDDFATVASGTNVTFADGNGTTAEVTKANDGSIAVKYNVKVADGLKLDGDKIVADTTVLTVADGKVTAPNNGDGKKFVDASGLADALNKLSWTATAGKEGTGEVDPANSAGQEVKAGDKVTFKAGDNLKIKQSGKDFTYSLKKELKDLTSVEFKDANGGTGSESTKITKDGLTITPAHGAGAAGANTANTISVTKDGISAGNKAVTNVVSGLKKFGDGHTLANGTVADFEKHYDNAYKDLTNLDEKGADNNPTVADNTAATVGDLRGLGWVISADKTTGEPNQEYNAQVRNANEVKFKSGNGINVSGKTLNGTRVITFELAKGEVVKSNEFTVKNADGSETNLVKVGDMYYSKEDIDPATSKPMTGKTEKYKVENGKVVSANGSKTEVTLTNKGSGYVTGNQVADAIAKSGFELGLADAAEAEKAFAESAKDKQLSKDKAETVNAHDKVRFANGLNTKVSAATVESTDANGDKVTTTFVKTDVELPLTQIYNTDANGNKIVKKADGKWYELNADGTASNKEVTLGNVDANGKKVVKVTENGADKWYYTSADGAADKTKGEVSNDKVSTDEKHVVRLDPNNQSNGKGVVIDNVANGEISATSTDAINGSQLYAVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW heparin Heparin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) hsf-vn-1 2843962 N/A 2843965 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843966 unspecified role unspecified role bait bait purified purified BD2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false PD2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2B vn-hsf-1 2843962 N/A 2843966 inhibitor inhibitor unspecified role unspecified role purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2843965 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843966 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2C hsf-vtn-2 2843962 N/A 2843965 unspecified role unspecified role prey prey purified purified region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false c teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843966 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3F & 4D q4ktx9_haeif-vtn-5 2843962 N/A 2843965 unspecified role unspecified role neutral component neutral component purified purified c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843966 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false S3 Multimeric Vn had a higher Hsf-binding capacity than monomeric Vn. Experiment for this interaction it not stated to be an ELISA, but probably is. q4ktx9_haeif-vtn-3 2843962 N/A 2843965 unspecified role unspecified role prey prey purified purified c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843966 unspecified role unspecified role bait bait purified purified n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 6A q4ktx9_haeif-vtn-4 2843962 N/A 2843965 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843966 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2C and 4 q4ktx9_haeif-vtn-6 2843962 N/A 2843967 inhibitor inhibitor unspecified role unspecified role N/A 2843965 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843966 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2C q4ktx9_haeif-vtn-7 2843962 N/A 2843966 inhibitor inhibitor unspecified role unspecified role purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2843965 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843966 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2C q4ktx9_haeif-vtn-8 2843962 N/A 2843966 inhibitor inhibitor unspecified role unspecified role purified purified BD2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2843965 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843966 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2C hsf-vn-2 2843963 N/A 2843965 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 N/A 2843966 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false 2843963 2D hsf-vn-3 2843963 N/A 2843965 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 N/A 2843966 unspecified role unspecified role bait bait BD2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false 2843963 2D q4ktx9_haeif-vtn-2 2843964 N/A 2843965 unspecified role unspecified role neutral component neutral component purified purified human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843966 unspecified role unspecified role neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false S4