IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ dyer-2014-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Dyer DP., Thomson JM., Hermant A., Jowitt TA., Handel TM., Proudfoot AE., Day AJ., Milner CM. Table 1 gives a value of 15,100 for the Kd for the rhTSG-6/CCL3 interaction;this is a negative result and not entered. CCL3, CCL5, and CXCL11 (provided by Amanda E. I. Proudfoot) have been entered with a Human origin, based on previous work of Ms Proudfoot: see pmids:25907556, 25266725, 20363748 ( from PDB entry). TSG-6 Link region has been entered as amino acids 36-133 -as quoted in both references 27 and 29. However reference 31 gives different residues. CXCL8/IL8 (also obtained from Ms Proudfoot/Pharmaceutical Research Laboratory, Geneva)- residue numbering has been entered here with respect to the full length sequence, including signal sequence. From mutation mapping IL-8(6-77) - the most predominant form, may have been used, but this is not stated in Ref 32. caroline.milner@manchester.ac.uk,anthony.day@manchester.ac.uk Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation dyer-2014-1 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Dyer DP., Thomson JM., Hermant A., Jowitt TA., Handel TM., Proudfoot AE., Day AJ., Milner CM. CCL3, CCL5, and CXCL11 (provided by Amanda E. I. Proudfoot) have been entered with a Human origin, based on previous work of Ms Proudfoot: see pmids:25907556, 25266725, 20363748 ( from PDB entry). TSG-6 Link region has been entered as amino acids 36-133 -as quoted in both references 27 and 29. However reference 31 gives different residues. CXCL8/IL8 (also obtained from Ms Proudfoot/Pharmaceutical Research Laboratory, Geneva)- residue numbering has been entered here with respect to the full length sequence, including signal sequence. From mutation mapping IL-8(6-77) - the most predominant form, may have been used, but this is not stated in Ref 32. caroline.milner@manchester.ac.uk,anthony.day@manchester.ac.uk Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation il8_human Interleukin-8 Protein 3-10C T-cell chemotactic factor CXCL8 C-X-C motif chemokine 8 Chemokine (C-X-C motif) ligand 8 Emoctakin Granulocyte chemotactic protein 1 IL8 Monocyte-derived neutrophil chemotactic factor Monocyte-derived neutrophil-activating peptide Neutrophil-activating protein 1 protein protein human Homo sapiens Human MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS tsg6_human Tumor necrosis factor-inducible gene 6 protein TSG6 TNFAIP6 Hyaluronate-binding protein TNF-stimulated gene 6 protein Tumor necrosis factor alpha-induced protein 6 protein protein human Homo sapiens Human MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFTDPKQIFKSPGFPNEYEDNQICYWHIRLKYGQRIHLSFLDFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL cxl11_human C-X-C motif chemokine 11 CXCL11 ITAC SCYB11 SCYB9B Beta-R1 H174 Interferon gamma-inducible protein 9 Interferon-inducible T-cell alpha chemoattractant Small-inducible cytokine B11 protein protein human Homo sapiens Human MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF ccl5_human C-C motif chemokine 5 CCL5 D17S136E SCYA5 EoCP Eosinophil chemotactic cytokine SIS-delta Small-inducible cytokine A5 T cell-specific protein P228 T-cell-specific protein RANTES protein protein human Homo sapiens Human MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS heparin Heparin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tnfaip6-cxcl8-4 1935968 N/A 1935970 unspecified role unspecified role prey prey Stoichiometry: 1.0 N/A 1935971 unspecified role unspecified role bait bait drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 1.0 direct interaction direct interaction false false false 1935968 Supp 1A, Table 1 tnfaip6-cxcl8-5 1935968 N/A 1935970 unspecified role unspecified role prey prey Stoichiometry: 1.0 N/A 1935971 unspecified role unspecified role bait bait drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 1.0 direct interaction direct interaction false false false 1935968 Supp 1D, Table 1 tnfaip6-cxcl8-6 1935968 N/A 1935970 unspecified role unspecified role prey prey P10145:p.Arg95Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 1935971 unspecified role unspecified role bait bait drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 1.0 direct interaction direct interaction false false false 1935968 Supp 1G, Table 1 tnfaip6-cxcl8-7 1935968 N/A 1935970 unspecified role unspecified role prey prey P10145:p.[Lys91Ala;Lys94Ala;Arg95Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 1935971 unspecified role unspecified role bait bait drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 1.0 direct interaction direct interaction false false false 1935968 Supp 1H, Table 1 Table 1 states that the Kd for the CXCL8_T mutant is 2,109;however the image for Supp Fig 1H states it is 2190. tnfaip6-cxcl8-8 1935968 N/A 1935971 unspecified role unspecified role bait bait link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1935970 unspecified role unspecified role prey prey Stoichiometry: 1.0 direct interaction direct interaction false false false 1935968 Supp fig 1B, Table 1 cxcl8-tnfaip6-3 1935968 N/A 1935971 unspecified role unspecified role bait bait link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1935970 unspecified role unspecified role prey prey Stoichiometry: 1.0 direct interaction direct interaction false false false 1935968 Supp fig 1E, Table 1 cxcl8-tnfaip6-4 1935968 N/A 1935971 unspecified role unspecified role bait bait link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1935970 unspecified role unspecified role prey prey P10145:p.Arg95Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 direct interaction direct interaction false false false 1935968 Supp fig 1I, Table 1 cxcl8-tnfaip6-5 1935968 N/A 1935970 unspecified role unspecified role bait bait Stoichiometry: 1.0 N/A 1935971 unspecified role unspecified role prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 1.0 direct interaction direct interaction false false false 1935968 Supp 1C, Table 1 cxcl8-tnfaip6-6 1935968 N/A 1935970 unspecified role unspecified role bait bait Stoichiometry: 1.0 N/A 1935971 unspecified role unspecified role prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 1.0 direct interaction direct interaction false false false 1935968 Supp 1F, Table 1 tnfaip6-cxcl8-9 1935968 N/A 1935972 unspecified role unspecified role prey prey Stoichiometry: 1.0 N/A 1935971 unspecified role unspecified role bait bait drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 1.0 direct interaction direct interaction false false false 1935968 Table 1 (row 11) tnfaip6-cxcl8-10 1935968 N/A 1935971 unspecified role unspecified role bait bait link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1935973 unspecified role unspecified role prey prey Stoichiometry: 1.0 direct interaction direct interaction false false false 1935968 Table 1 (row 10) tnfaip6-cxcl8-2 1935969 N/A 1935970 unspecified role unspecified role prey prey N/A 1935971 unspecified role unspecified role bait bait link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2A tnfaip6-cxcl8-1 1935969 N/A 1935971 competitor competitor competitor prey prey ecoli Escherichia coli (strain K12) N/A 1935970 unspecified role unspecified role bait bait N/A 1935971 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1935969 2B tnfaip6-cxcl8-3 1935969 N/A 1935970 unspecified role unspecified role prey prey N/A 1935971 unspecified role unspecified role bait bait drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction false false false 2Ai cxcl8-tnfaip6-1 1935969 N/A 1935970 unspecified role unspecified role bait bait N/A 1935971 unspecified role unspecified role prey prey link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2B-1 cxcl8-tnfaip6-2 1935969 N/A 1935974 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1935970 unspecified role unspecified role bait bait P10145:p.Arg95Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P10145:p.[Lys91Ala;Lys94_Arg95delinsAlaAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1935969 3A It is stated:-"KD values of 5 ± 12 and 26 ± 11 nM were determined for the binding of b-heparin to WT CXCL8 and CXCL8_D, respectively (A)." However no construct with the name of CXCL8_D is described elsewhere. cxcl8-heparin-1 1935969 N/A 1935974 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1935971 competitor competitor competitor prey prey P98066:p.[Lys69Ala;Lys89Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P98066:p.[Lys55Ala;Lys69Ala;Lys76Ala] mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false link_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1935970 unspecified role unspecified role bait bait direct interaction direct interaction false false false 1935969 3B-1/C cxcl8-heparin-2 1935969 N/A 1935974 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1935971 competitor competitor competitor prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. N/A 1935970 unspecified role unspecified role bait bait direct interaction direct interaction false false false 1935969 3B-2