UniProt UniProt http://www.uniprot.org quagliarini-2012-1 mouse-plasma mouse-plasma Mouse plasma blood plasma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Quagliarini F., Wang Y., Kozlitina J., Grishin NV., Hyde R., Boerwinkle E., Valenzuela DM., Murphy AJ., Cohen JC., Hobbs HH. Helen.Hobbs@UTSouthwestern.edu Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Only protein-protein interactions angl8_human Angiopoietin-like protein 8 Betatrophin C19orf80 Lipasin RIFL Refeeding-induced fat and liver protein ANGPTL8 UNQ599/PRO1185 protein protein human Homo sapiens Human MPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA angl3_human Angiopoietin-related protein 3 ANGPTL3 ANGPT5 UNQ153/PRO179 Angiopoietin-like protein 3 Angiopoietin-5 protein protein human Homo sapiens Human MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE c19orf80-angptl3-1 1906953 N/A 1906954 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1906955 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false 3E ANGPTL3 N-terminus is sufficient for the association as shown by a N-terminus-specific antibody