IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ effantin-2013-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Effantin G., Dordor A., Sandrin V., Martinelli N., Sundquist WI., Schoehn G., Weissenhorn W. The CHMP4B constructs contain a 20 aa linker (SNSASDDASASASADEDASS) between the 1-175 aa and 204-224 aa regions. weissenhorn@embl.fr Cellular microbiology 2013 Only protein-protein interactions imex curation imex curation effantin-2013-1 in vitro In vitro enzymatic footprint enzymatic footprinting enzymatic footprint ms participant Identification by mass spectrometry ms participant Effantin G., Dordor A., Sandrin V., Martinelli N., Sundquist WI., Schoehn G., Weissenhorn W. Only the proteolytic fragments of CHMP3 were identified by MS, CHMP2AdeltaC was identified by weight by staining. weissenhorn@embl.fr Cellular microbiology 2013 Only protein-protein interactions imex curation imex curation chm2a_human Charged multivesicular body protein 2a BC2 CHMP2 Chromatin-modifying protein 2a Putative breast adenocarcinoma marker BC-2 Vacuolar protein sorting-associated protein 2-1 CHMP2A protein protein human Homo sapiens Human MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD chm4b_human Charged multivesicular body protein 4b Chromatin-modifying protein 4b Vacuolar protein sorting-associated protein 32-2 SNF7-2 SNF7 homolog associated with Alix 1 CHMP4B C20orf178 SHAX1 protein protein human Homo sapiens Human MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIADQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSM chmp3_human Charged multivesicular body protein 3 CHMP3 CGI149 Chromatin-modifying protein 3 NEDF Neuroendocrine differentiation factor VPS24 Vacuolar protein sorting-associated protein 24 CGI-149 protein protein human Homo sapiens Human MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLRS chm2b_human Charged multivesicular body protein 2b Chromatin-modifying protein 2b CHMP2.5 Vacuolar protein sorting-associated protein 2-2 CHMP2B CGI-84 protein protein human Homo sapiens Human MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD chmp4b-chmp2a-1 1902722 N/A 1902724 unspecified role unspecified role prey prey mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 9-161 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1902725 unspecified role unspecified role bait bait 1-175, 204-224 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1902722 Fig. S8A chmp4b-chmp3-1 1902722 N/A 1902726 unspecified role unspecified role prey prey his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1902725 unspecified role unspecified role bait bait 1-175, 204-224 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. S8B 2 different kDs were measured, 0.15x10^-6 and 69x10^-6 probably reflecting CHMP3 polymerisation at higher concentrations. chmp2a-chmp3-2 1902722 N/A 1902726 unspecified role unspecified role prey prey his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1902724 unspecified role unspecified role bait bait mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 9-161 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1902722 Fig. S8C chmp4b-chmp2b-1 1902722 N/A 1902727 unspecified role unspecified role prey prey his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 1902725 unspecified role unspecified role bait bait 1-175, 204-224 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1902722 Fig. S8D (upper panel) chmp2b-chmp3-1 1902722 N/A 1902726 unspecified role unspecified role prey prey 9-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1902727 unspecified role unspecified role bait bait his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1902722 Fig. S8D (middle panel) chmp2a-chmp3-1 1902723 N/A 1902726 unspecified role unspecified role unspecified role unspecified role his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1902724 unspecified role unspecified role unspecified role unspecified role 9-161 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) protein cleavage protein cleavage false false false Fig. 6