IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ giulianelli-2012-8 human-t47d human breast cancer tumour cell line-epithelial cells t47d Epithelial cells derived from human breast tumour ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Only protein-protein interactions giulianelli-2012-9 human-t47d human breast cancer tumour cell line-epithelial cells t47d Epithelial cells derived from human breast tumour ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. ChIP-re-ChIP. There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Only protein-protein interactions giulianelli-2012-2 mouse-c4hd Mouse C4HD - ER+and PR+ progestin (MPA) induced mammary adenocarcinoma cell line c4hd C4HD Mouse ER+and PR+ progestin (MPA) induced mammary adenocarcinoma cell line confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Only protein-protein interactions giulianelli-2012-3 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Transplanted MPA-treated C4-HD tumors. There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Only protein-protein interactions giulianelli-2012-5 human-breast_cancer Homo sapiens breast cancer tissue breast_cancer Breast cancer tissue anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. PR+/ER+ Invasive ductal carcinoma cells There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Only protein-protein interactions giulianelli-2012-7 human-t47d human breast cancer tumour cell line-epithelial cells t47d Epithelial cells derived from human breast tumour anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. PR+/ER+ Invasive ductal carcinoma cells There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Only protein-protein interactions giulianelli-2012-1 mouse Mus musculus Mouse confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. Transplanted MPA-treated C4-HD tumors. There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Only protein-protein interactions giulianelli-2012-4 human-breast_cancer Homo sapiens breast cancer tissue breast_cancer Breast cancer tissue confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. PR+/ER+ Invasive ductal carcinoma cells There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Only protein-protein interactions giulianelli-2012-6 human-t47d human breast cancer tumour cell line-epithelial cells t47d Epithelial cells derived from human breast tumour confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Giulianelli S., Vaqué JP., Soldati R., Wargon V., Vanzulli SI., Martins R., Zeitlin E., Molinolo AA., Helguero LA., Lamb CA., Gutkind JS., Lanari C. PR+/ER+ Invasive ductal carcinoma cells There are several references to various isoforms of the Progesterone Receptor in this publication;however currently neither the UniProt nor NCBI databases list any isoforms for the mouse protein. There are 5 reviewed entries for the Human protein in UniProt, and 4 for Ref_Seq (of which only 3 are found in Uniprot) . lanari.claudia@gmail.com,giulianelli@cenpat-conicet.gob.ar Sandra asks for Sebastian Giulianelli, PhD to be notified when these are done. giulianelli@cenpat-conicet.gob.ar**********DONE Cancer research 2012 imex curation Only protein-protein interactions prgr_human Progesterone receptor PGR NR3C3 Nuclear receptor subfamily 3 group C member 3 protein protein human Homo sapiens Human MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGKPRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLGPPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPCKAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPPYLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK ccnd1_human_gene Human Cyclin D1 gene gene gene human Homo sapiens Human esr1_human Estrogen receptor ESR1 ESR NR3A1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein human Homo sapiens Human MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV myc_human_gene Human c-myc gene gene gene human Homo sapiens Human esr1_mouse Estrogen receptor Esr1 Esr Estr Estra Nr3a1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein mouse Mus musculus Mouse MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAYEFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI prgr_mouse Progesterone receptor Pgr Nr3c3 Pr Nuclear receptor subfamily 3 group C member 3 protein protein mouse Mus musculus Mouse MTELQAKDPQVLHTSGASPSPPHIGSPLLARLDSGPFQGSQHSDVSSVVSPIPISLDGLLFPRSCRGPELPDGKTGDQQSLSDVEGAFSGVEATHREGGRNSRAPEKDSRLLDSVLDSLLTPSGTEQSHASPPACEAITSWCLFGPELPEDPRSVPATKGLLSPLMSRPEIKAGDSSGTGAGQKVLPKGLSPPRQLLLPTSGSAHWPGAGVKPSPQPAAGEVEEDSGLETEGSAAPLLKSKPRALEGTGSGGGVAANAASAAPGGVTLVPKEDSRFSAPRVSLEQDSPIAPGRSPLATTVVDFIHVPILPLNHALLAARTRQLLEGDSYDGGATAQGPFAPPRGSPSAPSPPVPCGDFPDCTYPLEGDPKEDVFPLYGDFQTPGLKIKEEEEGADAAVRSPRPYLSAGASSSTFPDFPLAPAPQRAPSSRPGEAAVAGGPSSAAVSPASSSGSALECILYKAEGAPPTQGSFAPLPCKPPAAGSCLLPRDSLPAAPATAAAPAIYQPLGLNGLPQLGYQAAVLKDSLPQVYPPYLNYLRPDSEASQSPQYGFDSLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRTLDGVALPQSVGLPNESQALGQRITFSPNQEIQLVPPLINLLMSIEPDVVYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKELSFYSLCLTMWQIPQEFVKLQVTHEEFLCMKVLLLLNTIPLEGLRSQSQFEEMRSSYIRELIKAIGLRQKGVVPSSQRFYQLTKLLDSLHDLVKQLHLYCLNTFIQSRTLAVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK pgr-ccnd1_human_gene-1 2865426 N/A 2865435 unspecified role unspecified role bait bait N/A 2865436 unspecified role unspecified role prey prey promoter_progesterone_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6C,7 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone). CHEBI:6716 increases the binding of P06401 to ENSG00000110092 CHEMBL1358 causes no change to the CHEBI:6716 stimulated binding of P06401 to ENSG00000110092 P03372 is not required for the binding of P06401 to ENSG00000110092 esr1-ccnd1_human_gene-1 2865426 N/A 2865437 unspecified role unspecified role bait bait N/A 2865436 unspecified role unspecified role prey prey promoter_oestrogen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6C, 7 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone). CHEBI:6716 increases the binding of P03372 to ENSG00000110092 CHEBI:6716 increases expression at RNA level of ENSG00000110092 CHEBI:6716 increases expression at protein level of ENSG00000110092 CHEMBL1358 decreases expression at RNA level of ENSG00000110092 ICI 182,780 (CHEMBL1358) P03372 is required for the CHEBI:6716 induced increase in expression at RNA level of ENSG00000110092 P03372 is not required for the CHEBI:6716 induced increase in binding of P06401 to ENSG00000110092 CHEMBL1358 decreases the CHEBI:6716 stimulated binding of P03372 to ENSG00000110092 CHEMBL1358 decreases expression at protein level of P03372 pgr-myc_human_gene-1 2865426 N/A 2865435 unspecified role unspecified role bait bait N/A 2865438 unspecified role unspecified role prey prey promoter_progesterone_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6C,7 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone). CHEBI:6716 increases the binding of P06401 to ENSG00000136997 CHEMBL1358 causes no change to the CHEBI:6716 stimulated binding of P06401 to ENSG00000136997 P03372 is not required for the binding of P06401 to ENSG00000136997 esr1-myc_human_gene-1 2865426 N/A 2865437 unspecified role unspecified role bait bait N/A 2865438 unspecified role unspecified role prey prey promoter_oestrogen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6C,7 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone). CHEBI:6716 increases the binding of P03372 to ENSG00000136997 CHEBI:6716 increases expression at RNA level of ENSG00000136997 CHEBI:6716 increases expression at protein level of ENSG00000136997 CHEMBL1358 decreases expression at RNA level of ENSG00000136997 ICI 182,780 (CHEMBL1358) P03372 is required for the CHEBI:6716 induced increase in expression at RNA level of ENSG00000136997 P03372 is not required for the CHEBI:6716 induced increase in binding of P06401 to ENSG00000136997 CHEMBL1358 decreases the CHEBI:6716 stimulated binding of P03372 to ENSG00000136997 pgr-ccnd1_human_gene-2 2865427 N/A 2865437 unspecified role unspecified role prey prey N/A 2865435 unspecified role unspecified role bait bait N/A 2865436 unspecified role unspecified role prey prey promoter_progesterone_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6C-5 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone). esr1-myc_human_gene-2 2865427 N/A 2865435 unspecified role unspecified role prey prey N/A 2865437 unspecified role unspecified role bait bait N/A 2865438 unspecified role unspecified role prey prey promoter_oestrogen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6C-7 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone). esr1-ccnd1_human_gene-3 2865427 N/A 2865437 unspecified role unspecified role bait bait N/A 2865435 unspecified role unspecified role prey prey N/A 2865436 unspecified role unspecified role prey prey promoter_oestrogen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6C-6 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone). esr1-myc_human_gene-3 2865427 N/A 2865435 unspecified role unspecified role bait bait N/A 2865437 unspecified role unspecified role prey prey N/A 2865438 unspecified role unspecified role prey prey promoter_progesterone_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6C-8 MPA--medroxyprogesterone acetate (CHEBI:6716), a progestin (synthetic progesterone). esr1-pgr-4 2865428 N/A 2865439 unspecified role unspecified role neutral component neutral component N/A 2865440 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2 MPA-medroxyprogesterone acetate, a progestin (synthetic progesterone). ICI 182.780 - an estrogen receptor antagonist esr1-pgr-5 2865428 N/A 2865439 unspecified role unspecified role neutral component neutral component possible_phosphoser122 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false N/A 2865440 unspecified role unspecified role neutral component neutral component possible_phosphoser163 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false possible_phosphoser294 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 2C MPA-medroxyprogesterone acetate, a progestin (synthetic progesterone). esr1-pgr-3 2865429 N/A 2865439 unspecified role unspecified role bait bait N/A 2865440 unspecified role unspecified role prey prey physical association physical association false false false 2D esr1-pgr-6 2865429 N/A 2865439 unspecified role unspecified role prey prey N/A 2865440 unspecified role unspecified role bait bait physical association physical association false false false 2Di esr1-pgr-8 2865430 N/A 2865437 unspecified role unspecified role bait bait N/A 2865435 unspecified role unspecified role prey prey physical association physical association false false false 3C Two isoforms of PR were detected, but their identity cannot be confirmed. esr1-pgr-9 2865430 N/A 2865437 unspecified role unspecified role prey prey N/A 2865435 unspecified role unspecified role bait bait physical association physical association false false false 3Ci Two isoforms of PR were detected, but their identity cannot be confirmed. esr1-pgr-11 2865431 N/A 2865437 unspecified role unspecified role prey prey N/A 2865435 unspecified role unspecified role bait bait possible_phosphoser294 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4B MPA-medroxyprogesterone acetate, a progestin (synthetic progesterone). Two isoforms of PR were detected, but their identity cannot be confirmed. pgr-esr1-1 2865431 N/A 2865437 unspecified role unspecified role bait bait N/A 2865435 unspecified role unspecified role prey prey possible_phosphoser294 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4Bi MPA-medroxyprogesterone acetate, a progestin (synthetic progesterone). Two isoforms of PR were detected, but their identity cannot be confirmed. esr1-pgr-2 2865432 N/A 2865439 unspecified role unspecified role neutral component neutral component N/A 2865440 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2D esr1-pgr-7 2865433 N/A 2865437 unspecified role unspecified role neutral component neutral component N/A 2865435 unspecified role unspecified role neutral component neutral component possible_phosphoser162 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false possible_phosphoser190 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 3A esr1-pgr-10 2865434 N/A 2865437 unspecified role unspecified role neutral component neutral component N/A 2865435 unspecified role unspecified role neutral component neutral component possible_phosphoser162 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false possible_phosphoser294 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 4A, Supp 3 MPA-medroxyprogesterone acetate, a progestin (synthetic progesterone). MPA increased the nuclear colocalization between ERa and PR during the first 5 to 10 minutes and then a decrease was observed after 30 minutes of treatment.