UniProt UniProt http://www.uniprot.org sarparanta-2012-1 chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B. Origin of overexpressed myc-STUB1 according Ref. 56 (PMID 16554822; sequence coordinates therein) bjarne.udd@netikka.fi Nature genetics 2012 imex curation Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B., Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B. Only protein-protein interactions sarparanta-2012-2 rat-skeletal_muscle rat skeletal muscle skeletal_muscle Skeletal muscle pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B. rat gastrocnemius muscle bjarne.udd@netikka.fi Nature genetics 2012 imex curation Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B., Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B. Only protein-protein interactions sarparanta-2012-3 in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B. IP with anti-V5 antibodies after dithiobis(succinimidyl propionate) exposure as cross-linker. bjarne.udd@netikka.fi Nature genetics 2012 imex curation Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B., Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B. Only protein-protein interactions bag3_cerae_protein African monkey BAG3 protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey o75190-2 DnaJ homolog subfamily B member 6 HHDJ1 Heat shock protein J2 MSJ-1 DNAJB6 HSJ2 MRJ MSJ1 protein protein human Homo sapiens Human MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFEDFFGNRRGPRGSRSRGTGSFFSAFSGFPSFGSGFSSFDTGFTSFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKMVNGRKITTKRIVENGQERVEVEEDGQLKSLTINGKEQLLRLDNK chip_human E3 ubiquitin-protein ligase CHIP CHIP STUB1 PP1131 Carboxy terminus of Hsp70-interacting protein STIP1 homology and U box-containing protein 1 CLL-associated antigen KW-8 Antigen NY-CO-7 RING-type E3 ubiquitin transferase CHIP protein protein human Homo sapiens Human MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY bag3_human BAG family molecular chaperone regulator 3 Bcl-2-associated athanogene 3 Bcl-2-binding protein Bis Docking protein CAIR-1 BAG3 BIS protein protein human Homo sapiens Human MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPKETPSSANGPSREGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQRFRTEAAAAAPQRSQSPLRGMPETTQPDKQCGQVAAAAAAQPPASHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYISIPVIHEQNVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSPARSSTPLHSPSPIRVHTVVDRPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSKPVSQKPPPPSEKVEVKVPPAPVPCPPPSPGPSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHPGVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP hspb8_rat Heat shock protein beta-8 Hspb8 Cryac Hsp22 Alpha-crystallin C chain Small stress protein-like protein HSP22 protein protein rat Rattus norvegicus (Rat) Rat MADGQLPFPCSYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTAPWPEWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRNPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSPFGESSFNNELPQDNQEVTCS dnjb6_rat DnaJ homolog subfamily B member 6 Dnajb6 Heat shock protein J2 Hsp40 homolog MRJ MSJ-1 protein protein rat Rattus norvegicus (Rat) Rat MVDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFDDFFGNRRGPRGSRSRGAGSFFSAFSGFPSFGSGFPAFDTGFTPFGSLGHGGLTSFSSASFGGSGMGNFKSISTSTKIVNGKKITTKRIVENGQERVEVEEDGQLKSLTINGVADENALAEECRRRGQPTPALAPGPAPAPARVPSQARPPTPAPTPAPAQTPAPSVSTRPQKPPRPAPTAKLVSKSNWEDEEQDRQRVPGNCDAPMTSAGLKEGGKRKKQKQKEDSKKKKSTKGNH q5u2u8_rat Bag3 rCG_40209 protein protein rat Rattus norvegicus (Rat) Rat MSAATQSPVMQMASGNGASDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPPEGPKETASSANGPSRDGSRLLPAREGHPIYPQLRPGYIPIPVHHEGSENRQPHLFHAYSQPGVQRFRTEAAAAAPQRSQSPLRGGVTETTQTDKQCGQVPAAATAQPPTAHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYIPIPVIHEQNITRPAAQPSFHQAQKTHYPAQQGEYQPQQPVYHKIQGDDWEPRPLRATSPFRSPVRGASSREGSPARSGTPVHCPSPIRVHTVVDRPQPMTHREPPPVTQPENKPESKPGLAGPDLPPGHIPIQVIRREADSKPVSQKPPPPAEKVEVKVSSAPIPCPSPGPAPSAVPSSPKNVAAEPKAAPSPAPAEAASLKSGDAEAPHKHPGVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEPEQPLQEIMGAVAADKDKKGPENEDPQTESQQLEAKAATPPNPSSTADSAGNPVAP d4a4t0_rat Stub1 rCG_34526 protein protein rat Rattus norvegicus (Rat) Rat MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGDEDDGHIRAQQACIEAKHDKYMADMNELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY mint hsp7c_rat Heat shock cognate 71 kDa protein Hspa8 Hsc70 Heat shock 70 kDa protein 8 Hsc73 protein protein rat Rattus norvegicus (Rat) Rat MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD hspb8_cerae_protein African monkey HSPB8 protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey dnajb6_cerae_protein African monkey DNAJB6 protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey dnajb6-bag3-1 2866224 N/A 2866227 unspecified role unspecified role prey prey N/A 2866228 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false O75190-2:p.Phe93Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Mutation phe93leu (assoiated with Limb-girdle muscular dystrophy 1E (LGMD1E) [MIM:603511] ) does not change the association N/A 2866229 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2866230 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association false false false Supplementary 9b dnajb6-bag3_cerae_protein-1 2866224 N/A 2866227 unspecified role unspecified role prey prey N/A 2866228 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false O75190-2:p.Phe93Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Supplementary 9a dnajb6-dnajb6-1 2866224 N/A 2866228 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection N/A 2866228 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supplementary 6a dnajb6-dnajb6-2 2866224 N/A 2866228 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false O75190-2:p.Phe93Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false N/A 2866228 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection O75190-2:p.Phe93Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Supplementary 6a dnajb6-hspb8-1 2866225 N/A 2866231 unspecified role unspecified role neutral component neutral component N/A 2866232 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5B bag3-dnajb6-1 2866225 N/A 2866233 unspecified role unspecified role neutral component neutral component N/A 2866232 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5B dnajb6-stub1-1 2866225 N/A 2866234 unspecified role unspecified role neutral component neutral component N/A 2866232 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5B dnajb6-hspa8-1 2866225 N/A 2866235 unspecified role unspecified role neutral component neutral component N/A 2866232 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5B dnajb6-bag3_cerae_protein-2 2866226 N/A 2866236 unspecified role unspecified role neutral component neutral component chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 N/A 2866227 unspecified role unspecified role neutral component neutral component chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 N/A 2866237 unspecified role unspecified role neutral component neutral component chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 N/A 2866228 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false O75190-2:p.Phe93Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 association association false false false 5a