IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ von-2010-1 in vitro In vitro protease assay protease assay western blot western blot Immuno blot Immuno blot von Marschall Z., Fisher LW. Proteins were purified from furin-inhibited cell culture media. Glycosaminoglycan and N-linked oligosaccharide chains were removed prior to electrophoresis. "Classic" BMP1 (BMP1–1) as used in figure 2/3 from R+D Systems, corresponds to Uniprot ID =P13497-2; a protein of 730 amino acids. Human isoform "BMP1–5" which lacks the CUB3 domain, corresponds to Uniprot ID P13497-4. The construct mDCN-4 (mouse BGN) is not mentioned in Ref 16 but only has one isoform listed in Uniprot. mTLD (mouse BMP1) clone ID6849066 -Invitrogen cannot be found, however there is also only one isoform listed in UniProt. Human Decorin, clone P2 (ref 16, Table 1) is probably a molecule of 359 amino acids -see pmid:3484330, obtained via Ref 16. lfisher@dir.nidcr.nih.gov Biochemical and biophysical research communications 2010 Only protein-protein interactions imex curation imex curation von-2010-2 in vitro In vitro cleavage cleavage assay cleavage edman degradation edman degradation von Marschall Z., Fisher LW. lfisher@dir.nidcr.nih.gov Biochemical and biophysical research communications 2010 Only protein-protein interactions imex curation imex curation pgs2_human Decorin DCN SLRR1B Bone proteoglycan II PG-S2 PG40 protein protein human Homo sapiens Human MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK p13497-2 Bone morphogenetic protein 1 BMP1 PCOLC Mammalian tolloid protein Procollagen C-proteinase protein protein human Homo sapiens Human MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSEKRPALQPPRGRPHQLKFRVQKRNRTPQ pgs1_mouse Biglycan Bgn Bone/cartilage proteoglycan I PG-S1 protein protein mouse Mus musculus Mouse MCPLWLLTLLLALSQALPFEQKGFWDFTLDDGLLMMNDEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK p13497-4 Bone morphogenetic protein 1 Mammalian tolloid protein Procollagen C-proteinase BMP1 PCOLC protein protein human Homo sapiens Human MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEGCYDLQVGKPLLWDRHCFRLSTHGPEMLGTALRG May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. bmp1_mouse Bone morphogenetic protein 1 Bmp1 Mammalian tolloid protein Procollagen C-proteinase protein protein mouse Mus musculus Mouse MPGVARPPLPLLSLPLLLLLLLLPRAGRPLDLADYTYDLGEEDAPELLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAAVLRQQTARRPSIKAAGNSSALGGQGTSGQPQRESRGRWRGRPRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEVQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPSIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGGKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSNLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCEHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFVEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGNRMFLRFYSDNSVQRKGFQASHSTECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEETDCGYDYIELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHSDDTISKKGFHLRYTSTKFQDTLHSRK bmp1-dcn-1 2825497 N/A 2825499 enzyme target enzyme target substrate substrate neutral component neutral component proprotein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-bmsc human Human bmsc Bone Marrow Stromal cells N/A 2825500 enzyme enzyme neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc protein cleavage protein cleavage false false false 2A, 3A bmp1-dcn-2 2825497 N/A 2825501 enzyme target enzyme target substrate substrate neutral component neutral component proprotein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-bmsc human Human bmsc Bone Marrow Stromal cells N/A 2825500 enzyme enzyme neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc protein cleavage protein cleavage false false false 2B, 3B bmp1-dcn-3 2825497 N/A 2825502 enzyme enzyme neutral component neutral component human-bmsc human Human bmsc Bone Marrow Stromal cells N/A 2825499 enzyme target enzyme target substrate substrate neutral component neutral component proprotein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-bmsc human Human bmsc Bone Marrow Stromal cells protein cleavage protein cleavage false false false 3A bmp1-dcn-4 2825497 N/A 2825503 enzyme enzyme neutral component neutral component human-bmsc human Human bmsc Bone Marrow Stromal cells N/A 2825499 enzyme target enzyme target substrate substrate neutral component neutral component proprotein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-bmsc human Human bmsc Bone Marrow Stromal cells protein cleavage protein cleavage false false false 3A-2 bgn-bmp1-1 2825497 N/A 2825501 enzyme target enzyme target substrate substrate neutral component neutral component proprotein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-bmsc human Human bmsc Bone Marrow Stromal cells N/A 2825502 enzyme enzyme neutral component neutral component human-bmsc human Human bmsc Bone Marrow Stromal cells protein cleavage protein cleavage false false false 3B bgn-bmp1-2 2825497 N/A 2825501 enzyme target enzyme target substrate substrate neutral component neutral component proprotein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-bmsc human Human bmsc Bone Marrow Stromal cells N/A 2825503 enzyme enzyme neutral component neutral component human-bmsc human Human bmsc Bone Marrow Stromal cells protein cleavage protein cleavage false false false 3B-2 bmp1-dcn-5 2825498 N/A 2825499 enzyme target enzyme target substrate substrate neutral component neutral component proprotein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false glu30 biological feature biological feature certain certain sequence position certain certain certain sequence position certain false human-bmsc human Human bmsc Bone Marrow Stromal cells N/A 2825500 enzyme enzyme neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc protein cleavage protein cleavage false false false no figure