UniProt UniProt http://www.uniprot.org sharma-2009-5 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu Molecular biology of the cell 2009 imex curation Only protein-protein interactions sharma-2009-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu Molecular biology of the cell 2009 imex curation Only protein-protein interactions sharma-2009-6 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu Molecular biology of the cell 2009 imex curation Only protein-protein interactions sharma-2009-1 in vitro In vitro pull down pull down sequence tag sequence tag identification sequence tag Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu Molecular biology of the cell 2009 imex curation Only protein-protein interactions sharma-2009-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu Molecular biology of the cell 2009 imex curation Only protein-protein interactions sharma-2009-4 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sharma M., Giridharan SS., Rahajeng J., Naslavsky N., Caplan S. Interactions involving transfected cherry-Rab8a or Rab8a constructs in yeast two-hybrid assays, and transfected GFP-H-Ras not included as Rab8a and H-Ras species origin cannot be established from the publication scaplan@unmc.edu Molecular biology of the cell 2009 imex curation Only protein-protein interactions ehd1_human EH domain-containing protein 1 Testilin CDABP0131 EHD1 PAST PAST1 PAST homolog 1 protein protein human Homo sapiens Human MFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQVVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE milk1_human MICAL-like protein 1 MICALL1 KIAA1668 MIRAB13 Molecule interacting with Rab13 protein protein human Homo sapiens Human MAGPRGALLAWCRRQCEGYRGVEIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFCSPGQAGVSPPRKGLAPCSPPSVAPTPVEPEDVAQGEELSSGSLSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLPGAYENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVPGGGPSSSAPAGAEADGPKASPEARPQIPTKPRVPGKLQELASPPAGRPTPAPRKASESTTPAPPTPRPRSSLQQENLVEQAGSSSLVNGRLHELPVPKPRGTPKPSEGTPAPRKDPPWITLVQAEPKKKPAPLPPSSSPGPPSQDSRQVENGGTEEVAQPSPTASLESKPYNPFEEEEEDKEEEAPAAPSLATSPALGHPESTPKSLHPWYGITPTSSPKTKKRPAPRAPSASPLALHASRLSHSEPPSATPSPALSVESLSSESASQTAGAELLEPPAVPKSSSEPAVHAPGTPGNPVSLSTNSSLASSGELVEPRVEQMPQASPGLAPRTRGSSGPQPAKPCSGATPTPLLLVGDRSPVPSPGSSSPQLQVKSSCKENPFNRKPSPAASPATKKATKGSKPVRPPAPGHGFPLIKRKVQADQYIPEEDIHGEMDTIERRLDALEHRGVLLEEKLRGGLNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFKTMKMLKLLGNKRDAKSKSPRDKS ehd3_human EH domain-containing protein 3 EHD3 EHD2 PAST3 PAST homolog 3 protein protein human Homo sapiens Human MFSWLGTDDRRRKDPEVFQTVSEGLKKLYKSKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMQGDMEGIIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPSVFGKDNKKKELVNNLAEIYGRIEREHQISPGDFPNLKRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPIQMVKGGAFEGTLHGPFGHGYGEGAGEGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSVLGKIWKLADIDKDGMLDDDEFALANHLIKVKLEGHELPNELPAHLLPPSKRKVAE ehd4_human EH domain-containing protein 4 Hepatocellular carcinoma-associated protein 10/11 EHD4 HCA10 HCA11 FKSG7 PAST4 PAST homolog 4 protein protein human Homo sapiens Human MFSWMGRQAGGRERAGGADAVQTVTGGLRSLYLRKVLPLEEAYRFHEFHSPALEDADFENKPMILLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGETEGSTPGNALVVDPKKPFRKLSRFGNAFLNRFMCSQLPNQVLKSISVIDSPGILSGEKQRISRGYDFCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDLIKRARLAKVHAYIISYLKKEMPSVFGKENKKRELISRLPEIYIQLQREYQISAGDFPEVKAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLPNSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRKSLPKAD rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL milk1_bovin MICAL-like protein 1 MICALL1 protein protein bovin Bos taurus (Bovine) Bovine MAGPRGALLAWCRRQCEGYRGVDIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFAGSGPAGVSSPRKGLVLSSPPSEASTPADPGDRAQGEECSSGSLSKQGSHRTPSSTCAACQQHVHLVQRYLADGKLYHRHCFRCRRCSSTLLPGAYRNGPEEGTFVCAEHCARLGPSGRSGARPGTPPQPKQQQLTEEAKEVEGGSPSPKATAGAEADVPKASPEGRPQVPTKPRVPGRPQELASPPASRPTPAPRKASESTAPTPPTPRPRSSLQQENLVEQGGGSGLVNGKLQEPPIPKPRGTPKLSERTPAPRKDPPWITLVQAEPKKKPAPLPPSSSPGPPPGQEGRQVENGGVDKAAPRGPEPKPYNPFEEEEEEPPAAPSPAPGPAPTPPESTPKSLHPWYGITPTSSPKTKKRPAPRAPSTSPLTLHASRLSRSEPPSATPSPALSVESLSSESSSQAPSEELLEPPVVPKSSSEPAVHAPGTPGTSASLSANSSLSSSGELVQPSMDRTPQASPGLAPNSRGSPGPPPAKPCSGTAPTPLVLVGDKSPAPSPGTSSPQLQVKSSCKENPFNRKPSPTASPSVKKATKGSKPARPPAPGHGFPLIKRKVQSDQYIPEEDIHGEIDTIERQLDALEHRGVLLEEKLRGGVNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWTEEDRGREKVLMQELVTLIEQRNAIVNCLDEDRQREEEEDKMLEAMIKKKEFQKETEPEGKKKGKFKTMKVLKLLGNKRDTKSKCPGDRS ehd1-micall1-7 2845352 N/A 2845358 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false eh_domain sufficient to bind sufficient binding region sufficient to bind range range range range false Q9H4M9:p.Lys483Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) EHD1 mutant construct lys483glu also interacts N/A 2845359 unspecified role unspecified role prey prey cell lysate cell lysate human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false 3 and supplemental 1B ehd3-micall1-4 2845352 N/A 2845360 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false eh_domain sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) N/A 2845359 unspecified role unspecified role prey prey cell lysate cell lysate human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false supplemental 1B micall1-1 2845352 N/A 2845361 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false eh_domain sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) N/A 2845359 unspecified role unspecified role prey prey cell lysate cell lysate human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false supplemental 1B ehd1-micall1-9 2845352 N/A 2845358 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) EHD1 mutant construct lys483glu also interacts N/A 2845359 stimulator stimulator prey prey cell lysate cell lysate human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 2845362 unspecified role unspecified role prey prey cell lysate cell lysate human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 association association false false false 6K ehd1-micall1-4 2845353 N/A 2845359 unspecified role unspecified role bait bait Q8N3F8:p.[Asn425Ala;Phe427Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 2845358 unspecified role unspecified role prey prey physical association physical association false false false 1B ehd1-micall1-6 2845353 N/A 2845359 unspecified role unspecified role prey prey N/A 2845358 unspecified role unspecified role bait bait physical association physical association false false false supplemental 1A ehd3-micall1-3 2845353 N/A 2845360 unspecified role unspecified role bait bait N/A 2845359 unspecified role unspecified role prey prey physical association physical association false false false supplemental 1A micall1-ehd1-3 2845354 N/A 2845359 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2845358 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 2C ehd1-micall1-8 2845354 N/A 2845359 unspecified role unspecified role neutral component neutral component N/A 2845358 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2F ehd1-micall1-3 2845355 N/A 2845358 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 2845363 unspecified role unspecified role prey prey bovin-brain Bos taurus brain brain Brain [cerebrum] physical association physical association false false false no figure ehd1-micall1-5 2845356 N/A 2845358 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 2845359 unspecified role unspecified role prey prey cell lysate cell lysate Q8N3F8:p.[Asn425Ala;Phe427Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false 1C micall1-ehd1-2 2845357 N/A 2845359 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2845358 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1D