UniProt UniProt http://www.uniprot.org cai-2009-2 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. Origin of Tal1 in Gal4-Tal1 construct according PMID 10527940 following Ref. 10 (PMID 14560005). Gal4-Eto2 and Mtgr1 plasmid ('...obtained from Joseph Amann..) have been described in PMID 11533236 and PMID 16227606, respectively. stephen.brandt@vanderbilt.edu Biochemical and biophysical research communications 2009 imex curation Only protein-protein interactions cai-2009-7 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu Biochemical and biophysical research communications 2009 imex curation Only protein-protein interactions cai-2009-6 mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu Biochemical and biophysical research communications 2009 imex curation Only protein-protein interactions cai-2009-1 mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu Biochemical and biophysical research communications 2009 imex curation Only protein-protein interactions cai-2009-3 mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line tap tandem affinity purification TAP TAP tap sequence tag sequence tag identification sequence tag Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu Biochemical and biophysical research communications 2009 imex curation Only protein-protein interactions cai-2009-4 mouse-fva mouse splenic proerythrocytoblasts infected with Friend erythroleukemia virus Mouse fva splenic proerythrocytoblasts infected with Friend erythroleukemia virus anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu Biochemical and biophysical research communications 2009 imex curation Only protein-protein interactions cai-2009-5 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cai Y., Xu Z., Xie J., Ham AJ., Koury MJ., Hiebert SW., Brandt SJ. stephen.brandt@vanderbilt.edu Biochemical and biophysical research communications 2009 imex curation Only protein-protein interactions mtg8r_mouse Protein CBFA2T2 Cbfa2t2 Cbfa2t2h MTG8-like protein MTG8-related protein 1 Mtgr1 protein protein mouse Mus musculus Mouse MVGVPGAAAFQLGCEKRVPAMPGSPVEVKIQSRSSPPIMPPLPPINPGGPRPVSFTPTALSNGINHSPPTLNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEKVRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARAAKQTPSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPERRDENNFERDTVPPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLEHREVRERHHNLSLNGGYQDELVDHRLTEREWADEWKHLDHALNCIMEMVEKTRRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSNDSQREFTSRPATGYVPVEFWKKTEEAVNKVKIQAMSEVQKAVAEAEQKAFEVIATERARMEQTIADVKRQAAEDAFLVINEQEESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQSLHGHSPHSQSRPLLPGGRGSARSADCSVPSPALDKTSATTSRSSTPASVTAIDANGL mint tal1_mouse T-cell acute lymphocytic leukemia protein 1 homolog Tal1 Scl Tal-1 Stem cell protein protein protein mouse Mus musculus Mouse MTERPPSEAARSDPQLEGQDAAEARMAPPHLVLLNGVAKETSRAAPAEPPVIELGARSGAGGGPASGGGAARDLKGRDAVAAEARLRVPTTELCRPPGPAPAPAPASAPAELPGDGRMVQLSPPALAAPAGPGRALLYSLSQPLASLGSGFFGEPDAFPMFTNNNRVKRRPSPYEMEISDGPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQRAKPGKDPVVGAGGGGAGGGIPPEDLLQDVLSPNSSCGSSLDGAASPDSYTEEPTPKHTSRSLHPALLPAADGAGPR mint Implicated in the genesis of hemopoietic malignancies. It may play an important role in hemopoietic differentiation. Serves as a positive regulator of erythroid differentiation Involved in chromosomal translocation in leukemic stem-cells mtg16_mouse Protein CBFA2T3 Cbfa2t3 Cbfa2t3h Mtgr2 Protein ETO-2 Eight twenty one protein 2 MTG8-related protein 2 protein protein mouse Mus musculus Mouse MSQASTTTLESGALLSGPRGLQYGSPAHRKEKAAAMPDSPAEVKTQPRSTPPSMPPPPPTSSQGATRPPSFTPHTHGEDGPATSLPHGRFHGCLKWSMVCLLMNGSSHSPTAIHGAPSTPNGFSNGPATSSTASLSTQHLPPACGARQLSKLKRFLTTLQQFGSDISPEIGERVRTLVLGLVNSTLTIEEFHAKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQTPAQYLAQHEQLLLDASATSPVDSSELLLEVNENGKRRTPDRTKENGSDRDPLHPDHLSKRSCTLSPAQRCSPSNGLPHPTPPPPPHYRLEDMAMAHHFRDSYRHPDPRELRERHRPLAIPGSRQEEVIDHRLTEREWAEEWKHLNSLLNCIMDMVEKTRRSLTVLRRCQEADREELNHWIRCYSDSEEGKKGPTPISARSLNSCSGPEGSQLDVHRDFTPRTLSGYMPEEIWRKAEEAVNEVKRQAMSELQKAVSDAERKAHELITTERAKMERALAEAKRQASEDALTVINQQEDSSESCWNCGRKASETCSGCNAARYCGSFCQHKDWEKHHHVCGQSLQGPAAAVADPLPGQPDATASPSEAGSAGPSRPCSPGPPGPLDAAVPR mint Functions as a transcriptional repressor. Regulates the proliferation and the differentiation of erythroid progenitors by repressing the expression of TAL1 target genes. Plays a role in granulocyte differentiation. May also function as an A-kinase-anchoring protein epb42_mouse_gene Erythrocyte membrane protein band 4.2 Epb42 Epb4.2 gene gene mouse Mus musculus Mouse glpa_mouse_gene Glycophorin-A Gypa gene gene mouse Mus musculus Mouse ldb1_mouse LIM domain-binding protein 1 Ldb1 Nli Carboxyl-terminal LIM domain-binding protein 2 LIM domain-binding factor CLIM2 Nuclear LIM interactor protein protein mouse Mus musculus Mouse MSVGCACPGCSSKSFKLYSPKEPPNGNAFPPFHPGTMLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMFTQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPARQQPSKRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAANGIDDEDSFNNSPALGANSPWNSKPPSSQESKSENPTSQASQ rbtn2_mouse Rhombotin-2 Lmo2 Rbtn-2 Rbtn2 Rhom-2 Cysteine-rich protein TTG-2 LIM domain only protein 2 T-cell translocation protein 2 protein protein mouse Mus musculus Mouse MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGII gata1_mouse Erythroid transcription factor Gata1 Gf-1 Eryf1 GATA-binding factor 1 NF-E1 DNA-binding protein protein protein mouse Mus musculus Mouse MDFPGLGALGTSEPLPQFVDSALVSSPSDSTGFFSSGPEGLDAASSSTSPNAATAAASALAYYREAEAYRHSPVFQVYPLLNSMEGIPGGSPYASWAYGKTALYPASTVCPSHEDAPSQALEDQEGKSNNTFLDTLKTERLSPDLLTLGTALPASLPVTGSAYGGADFPSPFFSPTGSPLSSAAYSSPKFHGSLPLAPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRMIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYFKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRGSNLAGAGAAEGPAGGFMVVAGSSSSGNCGEVASGLALGTAGTAHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTTSFPTGPAPTTSSTSVIAPLSS tal1-cbfa2t2-2 2866154 N/A 2866161 unspecified role unspecified role prey prey N/A 2866162 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2866163 unspecified role unspecified role prey prey physical association physical association false false false 1B tal1-cbfa2t2-6 2866154 N/A 2866163 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection N/A 2866161 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection N/A 2866162 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false association association false false false 4A tal1-cbfa2t2-8 2866154 N/A 2866163 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2866162 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association false false false 4B tal1-cbfa2t3-7 2866155 N/A 2866163 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 2866162 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 3B Tcf3/E47 tal1-cbfa2t2-7 2866155 N/A 2866161 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 2866162 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 3C Cbfa2t3/Eto2 3465s4yerg-1 2866156 N/A 2866163 unspecified role unspecified role bait bait N/A 2866164 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4E DMSO cbfa2t3-epb42-1 2866156 N/A 2866163 unspecified role unspecified role bait bait N/A 2866165 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4Ei DMSO tal1-cbfa2t2-1 2866157 N/A 2866161 unspecified role unspecified role prey prey N/A 2866162 unspecified role unspecified role bait bait N/A 2866163 unspecified role unspecified role prey prey physical association physical association false false false 1C and 2A DMSO (causing cell differentiation) tal1-cbfa2t2-3 2866158 N/A 2866162 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2866163 unspecified role unspecified role prey prey N/A 2866161 unspecified role unspecified role prey prey N/A 2866166 unspecified role unspecified role prey prey N/A 2866167 unspecified role unspecified role prey prey N/A 2866168 unspecified role unspecified role prey prey association association false false false supplemental figure and text tal1-cbfa2t2-4 2866159 N/A 2866163 unspecified role unspecified role prey prey N/A 2866161 unspecified role unspecified role prey prey N/A 2866162 unspecified role unspecified role bait bait physical association physical association false false false 2B Erythropoetin (causing cell differentiation) tal1-cbfa2t2-5 2866160 N/A 2866163 unspecified role unspecified role prey prey N/A 2866161 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection N/A 2866162 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 3A Greater amounts of Eto2 and Mtgr1 were precipitated in cells transduced with both proteins, rather than one.