UniProt UniProt http://www.uniprot.org mamada-2009-1 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Mamada H., Takahashi N., Taira M. Origin of lemd3/ XMAN1 according Osada et al., 2003 (PMID 12642484). m_taira@bs.s.u-tokyo.ac.jp Developmental biology 2009 imex curation Only protein-protein interactions mamada-2009-2 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy immunostaining immunostaining Mamada H., Takahashi N., Taira M. m_taira@bs.s.u-tokyo.ac.jp Developmental biology 2009 imex curation Only protein-protein interactions mamada-2009-3 xenla-embryo Xenopus laevis embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. confocal microscopy confocal microscopy immunostaining immunostaining Mamada H., Takahashi N., Taira M. m_taira@bs.s.u-tokyo.ac.jp Developmental biology 2009 imex curation Only protein-protein interactions bafb_xenla Barrier-to-autointegration factor B banf1-b baf-b protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSSTSQKHRDFVAEPMGEKSVQCLAGIGDTLGRRLEEKGFDKAYVVLGQFLVLKKDEELFKEWLKDACSANAKQSRDCYGCLKEWCDAFL nmp1a_xenla Nuclear envelope integral membrane protein 1a nemp1a tmem194a-a protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAGDVEGGGCRVSWGALLTLLLLPLPSLCTLASGKEPHVIKLYEGKVVRYNESKNFCYQRTYEPKWSDVWTKIQIRVNSTKMIRVTQVENEEKLKEMETFNMFDLFSSFLKEKLNDTFIYVDLYSNKTCIKVHVIDTDTYYSVALSRGFDPRLCFLFLCGLLLFFYGDALSRSQLFFYSTGITIGMLASMLILVFMLSKLMPKKSPFVALLLGGWSVSIYIIQLVFKNLQAICSEYWQYLLGYLGIVGFVSFAFCYKYGPLENDRSINILTWTLQLIGLLLMYISVQIQHIAVTMVVIAFCTKQIEYPVQWIYILYRKIKRKRAKPSPPRLLTEEEYRKQGEIETRKALEELRGYCSSPDFATWKMISRIQSPKRFADFVEGSSHLTPNEVSVHEHEYGLGGSFLEDELFGEDSDIEVEMDIEQPLYLVPRSCF q7ztb4_xenla lemd3.S XMAN1 lemd3 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAAAQLTDEELFSELKRSGIMPGPVTDSTRPVYLKKLKKLREEQRLRHGKVRVITNNNTVAAPSESEGILKSGGDVTHKRYSRQSLAREAGKPSPILGFSSDESDVDAGLGAHGSRRSRTNTPQPERKSPVQHQPGTADANADRRKVPGWWEMRRPRGDSEEDDDDEEEGTEEASNCRTMNGSRHSYCRDYSDTDEEEQLGQDEQASRRSRRGSSKQAKEQSLDRDELAAWPGWSREVAGVSHRHRGAARKSHTAADTDGAGNLKRKSNNHLESGYNKDPPRVYFPSNSLPPRMPQSNHTAAPNHTKYSHYHYPDSKRQHHKVAEPEEALLQQFKRDEVSAAGRFSAHYLSMFLLTAACLFFLLLGLTYLRMRGTSLPANENLTSTEDLNVDSKKNLMNTLQKLHEKLSKTAGDYICGNTDHRNISVQEAKQYLRTLGQEYENEFNNTLAWILEHSATRDIGIKCVSDPGSILNITSVKYLESTLPKMSFMCRIKRAVITVAHRSSILLVGVGVLFGVWRYIKYRWAKEEEETKQMYDMVVKIIDVLKSHNEACQENKGLEPYTPIPHVRDSLILPQDRKKMKKVWDRAVEFLDANESRVRTETQKIGGADFQVWKWIQPSSTCDKISVMPSKVWQGQAFHLDRRNSPPNSLTPCLKIRNMFDPVMEIGDHWDLAIQEAILEKCSDNEGIVHIAVDKNSREGCVYVKCLSPEFAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTCSTPLKPSNTHMNSLLHLNLRTGTSNSQSCC nemp1a-banf1_b-1 2866385 N/A 2866388 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false xenla-embryo Xenopus laevis embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. N/A 2866389 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 7B lemd3-banf1_b-1 2866385 N/A 2866390 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2866388 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false xenla-embryo Xenopus laevis embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. physical association physical association false false false 7B nemp1a-banf1_b-2 2866386 N/A 2866388 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 2866389 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false 7C banf1_b-nemp1a-1 2866387 N/A 2866388 unspecified role unspecified role neutral component neutral component microinjection microinjection micro-injection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 2866389 unspecified role unspecified role neutral component neutral component microinjection microinjection micro-injection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false 7D