UniProt UniProt http://www.uniprot.org shan-2009-1 in vitro In vitro lipase assay lipase assay predetermined predetermined participant predetermined Shan L., Yu XC., Liu Z., Hu Y., Sturgis LT., Miranda ML., Liu Q. lshan@lexpharma.com Ishan@lexpharma.com The Journal of biological chemistry 2009 imex curation Only protein-protein interactions shan-2009-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Shan L., Yu XC., Liu Z., Hu Y., Sturgis LT., Miranda ML., Liu Q. lshan@lexpharma.com Ishan@lexpharma.com The Journal of biological chemistry 2009 imex curation Only protein-protein interactions lipl_human Lipoprotein lipase LPL LIPD Phospholipase A1 protein protein human Homo sapiens Human MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG angl3_human Angiopoietin-related protein 3 ANGPTL3 ANGPT5 UNQ153/PRO179 Angiopoietin-like protein 3 Angiopoietin-5 protein protein human Homo sapiens Human MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE 1,2-di-o-lauryl-rac-glycero-3-glutaric acid 6'-methylresorufin ester 1,2-di-O-lauryl-rac-glycero-3-glutaric acid 6'-methylresorufin ester 1,2-di-O-dodecyl-rac-glycero-3-glutaric acid 6'-methylresorufin ester DGGR 1-[2,3-bis(dodecyloxy)propyl] 6-methyl-3-oxo-3H-phenoxazin-7-yl pentanedioate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) angl4_human Angiopoietin-related protein 4 ANGPTL4 ARP4 HFARP PGAR Angiopoietin-like protein 4 Hepatic fibrinogen/angiopoietin-related protein PP1158 PSEC0166 UNQ171/PRO197 protein protein human Homo sapiens Human MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS angptl3-lpl-1 1906961 N/A 1906963 enzyme enzyme unspecified role unspecified role c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 1906964 inhibitor inhibitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1906965 enzyme target enzyme target substrate substrate unspecified role unspecified role lipid cleavage lipid cleavage false false false 1B aand 2B Heparin can neutralize the inhibitory effect of ANGPTL3 on LPL activity angptl4-lpl-1 1906961 N/A 1906966 inhibitor inhibitor unspecified role unspecified role Q9BY76:p.Glu40Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1906963 enzyme enzyme unspecified role unspecified role c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 1906965 enzyme target enzyme target substrate substrate unspecified role unspecified role lipid cleavage lipid cleavage false false false 1906961 1A , 2A and 3A Heparin cannot neutralize the inhibitory effect of ANGPTL4 on LPL activity. The glu40lys point mutation caused a significant loss of the inactivating effects of ANGPTL4 on LPL. angptl4-lpl-2 1906961 N/A 1906965 enzyme target enzyme target substrate substrate unspecified role unspecified role N/A 1906966 inhibitor inhibitor unspecified role unspecified role n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9BY76:p.[Cys76Ser;Cys80Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1906963 enzyme enzyme unspecified role unspecified role c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. lipid cleavage lipid cleavage false false false 1906961 1C Effect on LPL activity of ANGPTL4 mutant is comparable to that of wildtype ANGPTL4 1,2_di_o_lauryl_rac_glycero_3_glutaric acid 6'_methylresorufin ester-lpl-2 1906961 N/A 1906965 enzyme target enzyme target substrate substrate unspecified role unspecified role N/A 1906963 enzyme enzyme unspecified role unspecified role c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. lipid cleavage lipid cleavage false false false 1 and 2 angptl4-1 1906962 n/a 1906966 unspecified role unspecified role unspecified role unspecified role n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3D angptl4-3 1906962 n/a 1906966 unspecified role unspecified role unspecified role unspecified role n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9BY76:p.[Cys76Ser;Cys80Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3D angptl4-5 1906962 n/a 1906966 unspecified role unspecified role unspecified role unspecified role Q9BY76:p.[Cys76Ser;Cys80Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3D