UniProt UniProt http://www.uniprot.org paronetto-2007-2 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Paronetto MP., Achsel T., Massiello A., Chalfant CE., Sette C. claudio.sette@uniroma2.it The Journal of cell biology 2007 imex curation Only protein-protein interactions paronetto-2007-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Paronetto MP., Achsel T., Massiello A., Chalfant CE., Sette C. claudio.sette@uniroma2.it The Journal of cell biology 2007 imex curation Only protein-protein interactions paronetto-2007-3 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Paronetto MP., Achsel T., Massiello A., Chalfant CE., Sette C. HEK293 nuclear extract has been used claudio.sette@uniroma2.it The Journal of cell biology 2007 imex curation Only protein-protein interactions paronetto-2007-4 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunostaining immunostaining Paronetto MP., Achsel T., Massiello A., Chalfant CE., Sette C. claudio.sette@uniroma2.it The Journal of cell biology 2007 imex curation Only protein-protein interactions khdr1_human KH domain-containing, RNA-binding, signal transduction-associated protein 1 SAM68 Src-associated in mitosis 68 kDa protein KHDRBS1 p21 Ras GTPase-activating protein-associated p62 GAP-associated tyrosine phosphoprotein p62 p68 protein protein human Homo sapiens Human MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYREHPYGRY roa1_human Heterogeneous nuclear ribonucleoprotein A1 HNRNPA1 HNRPA1 Helix-destabilizing protein Single-strand RNA-binding protein hnRNP core protein A1 protein protein human Homo sapiens Human MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF hnrnpa1-khdrbs1-2 1938628 N/A 1938632 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1938633 unspecified role unspecified role prey prey physical association physical association false false false 7C and D Association not changed in presence of RNase khdrbs1-hnrnpa1-5 1938628 N/A 1938632 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q07666:p.Val229Phe mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false N/A 1938633 unspecified role unspecified role prey prey physical association physical association false false false 8A Tyrosine-protein kinase Fyn hnrnpa1-khdrbs1-1 1938629 N/A 1938632 unspecified role unspecified role bait bait N/A 1938633 unspecified role unspecified role prey prey physical association physical association false false false 7B khdrbs1-hnrnpa1-3 1938630 N/A 1938632 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1938633 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 7 E khdrbs1-hnrnpa1-4 1938631 N/A 1938632 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q07666:p.Val229Phe mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false N/A 1938633 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 7A, Supp fig 3