IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wilkinson-2007-1 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wilkinson ML., Crary SM., Jackman JE., Grayhack EJ., Phizicky EM. eric_phizicky@urmc.rochester.edu RNA (New York, N.Y.) 2007 imex curation Only protein-protein interactions imex curation wilkinson-2007-2 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as sequence tag sequence tag identification sequence tag Wilkinson ML., Crary SM., Jackman JE., Grayhack EJ., Phizicky EM. eric_phizicky@urmc.rochester.edu RNA (New York, N.Y.) 2007 imex curation Only protein-protein interactions imex curation wilkinson-2007-3 in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wilkinson ML., Crary SM., Jackman JE., Grayhack EJ., Phizicky EM. eric_phizicky@urmc.rochester.edu RNA (New York, N.Y.) 2007 imex curation Only protein-protein interactions imex curation trna_gly_gcc tRNA_Gly_GCC trna transfer rna transfer ribonucleic acid tRNA transfer RNA trna yeast Saccharomyces cerevisiae Baker's yeast GCGCAAGUGGUUUAGUGGUAAAAUCCAACGUUGCCAUCGUUGGGCCCCCGGUUCGAUUCCGGGCUUGCGCA trm13_yeast tRNA:m(4)X modification enzyme TRM13 tRNA methylase 13 TRM13 YOL125W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLQDNNGPAVKRAKPSERLQCEYFMEKKKRRCGMTRSSQNLYCSEHLNLMKKAANSQVHNKNGSEAEKERERVPCPLDPNHTVWADQLKKHLKKCNKTKLSHLNDDKPYYEPGYNGENGLLSSSVKIDITAEHLVQSIELLYKVFEGESMDELPLRQLNNKLMSLKRFPQLPSNTKHAVQQSSLIENLVDAGAFERPESLNFIEFGCGRAEFSRYVSLYLLTQLTSLPAEHSGSNSNEFVLIDRATNRMKFDKKIKDDFSEIKSNSPSKPISCPSIKRIKIDIRDLKMDPILKSTPGDDIQYVCISKHLCGVATDLTLRCIGNSSILHGDDNNGCNPKLKAICIAMCCRHVCDYGDYVNRSYVTSLVEKYRAHGSILTYETFFRVLTKLCSWGTCGRKPGTAITDIVNVVESFEGAEPYTITIKERENIGLMARRVIDEGRLVYVKEKFTEFNAELIRYVESDVSLENVAMLVYKK trna his gtg trna His GTG trna transfer rna transfer ribonucleic acid tRNA transfer RNA trna yeast Saccharomyces cerevisiae Baker's yeast GCCAUCUUAGUAUAGUGGUUAGUACACAUCGUUGUGGCCGAUGAAACCCUGGUUCGAUUCUAGGAGAUGGCA trm13 trnagly-1 2845905 N/A 2845908 enzyme target enzyme target substrate substrate neutral component neutral component label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false methylation rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 2845909 enzyme enzyme neutral component neutral component label tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) methylation methylation reaction methylation false false false Fig 1D trm13-trna his gtg-1 2845905 N/A 2845910 enzyme target enzyme target substrate substrate neutral component neutral component A methylation rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain false label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 2845909 enzyme enzyme neutral component neutral component tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) methylation methylation reaction methylation false false false 2845905 2845905 Fig 6 trm13-trna_gly_gcc-1 2845906 N/A 2845908 enzyme target enzyme target substrate substrate neutral component neutral component methylation rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 2845909 enzyme enzyme neutral component neutral component tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) methylation methylation reaction methylation false false false Fig 4B, Table 2 trm13-trna_gly_gcc-3 2845906 N/A 2845908 enzyme target enzyme target substrate substrate neutral component neutral component methylation rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 2845909 enzyme enzyme neutral component neutral component tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeast Saccharomyces cerevisiae Baker's yeast methylation methylation reaction methylation false false false Fig 4B, Table 2 trna his_trm13-1 2845907 N/A 2845909 unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2845910 unspecified role unspecified role bait bait label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 2845907 Fig5 trm13-trna_gly_gcc-2 2845907 N/A 2845909 unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2845908 unspecified role unspecified role bait bait label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 2845907 Fig5