IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ reynard-2000-5 yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Reynard GJ., Reynolds W., Verma R., Deshaies RJ. Kinase expts assayed using Histone H1 as substrate were not included as the origin of the H1 was not given. deshaies@its.caltech.edu Molecular and cellular biology 2000 Only protein-protein interactions imex curation imex curation Reynard GJ., Reynolds W., Verma R., Deshaies RJ., Reynard GJ., Reynolds W., Verma R., Deshaies RJ. reynard-2000-1 spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection pull down pull down anti tag western anti tag western blot anti tag western Reynard GJ., Reynolds W., Verma R., Deshaies RJ. Kinase expts assayed using Histone H1 as substrate were not included as the origin of the H1 was not given. deshaies@its.caltech.edu Molecular and cellular biology 2000 Only protein-protein interactions imex curation imex curation Reynard GJ., Reynolds W., Verma R., Deshaies RJ., Reynard GJ., Reynolds W., Verma R., Deshaies RJ. reynard-2000-2 spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Reynard GJ., Reynolds W., Verma R., Deshaies RJ. Kinase expts assayed using Histone H1 as substrate were not included as the origin of the H1 was not given. deshaies@its.caltech.edu Molecular and cellular biology 2000 Only protein-protein interactions imex curation imex curation Reynard GJ., Reynolds W., Verma R., Deshaies RJ., Reynard GJ., Reynolds W., Verma R., Deshaies RJ. cdk1_yeast Cyclin-dependent kinase 1 CDC28 CDK1 HSL5 SRM5 YBR1211 YBR160W Cell division control protein 28 Cell division protein kinase 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQLCKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIVYLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES 57A7A2B97A90DC6C cg12_yeast G1/S-specific cyclin CLN2 CLN2 YPL256C protein protein yeast Saccharomyces cerevisiae Baker's yeast MASAEPRPRMGLVINAKPDYYPIELSNAELLSHFEMLQEYHQEISTNVIAQSCKFKPNPKLIDQQPEMNPVETRSNIITFLFELSVVTRVTNGIFFHSVRLYDRYCSKRIVLRDQAKLVVATCLWLAAKTWGGCNHIINNVVIPTGGRFYGPNPRARIPRLSELVHYCGDGQVFDESMFLQMERHILDTLNWNIYEPMINDYVLNVDENCLMQYELYENQVTYDKQCSEKRQSQLSQDSDATVDERPYQNEEEEEEDLKLKIKLINLKKFLIDVSAWQYDLLRYELFEVSHGIFSIINQFTNQDHGPFLMTPMTSESKNGEILSTLMNGIVSIPNSLMEVYKTVNGVLPFINQVKEYHLDLQRKLQIASNLNISRKLTISTPSCSFENSNSTSIPSPASSSQSHTPMRNMSSLSDNSVFSRNMEQSSPITPSMYQFGQQQSNSICGSTVSVNSLVNTNNKQRIYEQITGPNSNNATNDYIDLLNLNESNKENQNPATAHYLNGGPPKTSFINHGMFPSPTGTINSGKSSSASSLISFGMGNTQVI D6426B94E040E960 cg13_yeast G1/S-specific cyclin CLN3 CLN3 DAF1 WHI1 YAL040C FUN10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAILKDTIIRYANARYATASGTSTATAASVSAASCPNLPLLLQKRRAIASAKSKNPNLVKRELQAHHSAISEYNNDQLDHYFRLSHTERPLYNLTNFNSQPQVNPKMRFLIFDFIMYCHTRLNLSTSTLFLTFTILDKYSSRFIIKSYNYQLLSLTALWISSKFWDSKNRMATLKVLQNLCCNQYSIKQFTTMEMHLFKSLDWSICQSATFDSYIDIFLFQSTSPLSPGVVLSAPLEAFIQQKLALLNNAAGTAINKSSSSQGPSLNINEIKLGAIMLCELASFNLELSFKYDRSLIALGAINLIKLSLNYYNSNLWENINLALEENCQDLDIKLSEISNTLLDIAMDQNSFPSSFKSKYLNSNKTSLAKSLLDALQNYCIQLKLEEFYRSQELETMYNTIFAQSFDSDSLTCVYSNATTPKSATVSSAATDYFSDHTHLRRLTKDSISPPFAFTPTSSSSSPSPFNSPYKTSSSMTTPDSASHHSHSGSFSSTQNSFKRSLSIPQNSSIFWPSPLTPTTPSLMSNRKLLQNLSVRSKRLFPVRPMATAHPCSAPTQLKKRSTSSVDCDFNDSSNLKKTR AF6950A7E68DB295 cks1_yeast Cyclin-dependent kinases regulatory subunit CKS1 YBR135W YBR1011 Cell division control protein CKS1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MYHHYHAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTLRILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRPLNYEAELRAATAAAQQQQQQQQQQQQQQQQHQTQSISNDMQVPPQIS 0DD0910E01D373FF cdc28-cln2-3 1907300 N/A 1907303 unspecified role unspecified role prey prey N/A 1907304 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5A cln2-cdc28-1 1907300 N/A 1907303 unspecified role unspecified role prey prey N/A 1907305 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6B cdc28-cks1-2 1907301 N/A 1907303 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1907304 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey N/A 1907306 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3A cdc28-cks1-3 1907302 N/A 1907303 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1907304 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3B