MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint zhang-2015-1 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhang M., Takano T., Liu S., Zhang X. xxzhang@nefu.edu.cn FEBS letters 2015 Only protein-protein interactions imex curation imex curation zhang-2015-2 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang M., Takano T., Liu S., Zhang X. xxzhang@nefu.edu.cn FEBS letters 2015 Only protein-protein interactions imex curation imex curation zhang-2015-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zhang M., Takano T., Liu S., Zhang X. xxzhang@nefu.edu.cn FEBS letters 2015 Only protein-protein interactions imex curation imex curation zhang-2015-4 tobac-by_2 Tobacco cell line by_2 Tobacco cell line An undifferentiated cell line derived from tobacco callus tissue. An undifferentiated cell line derived from tobacco callus tissue. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Zhang M., Takano T., Liu S., Zhang X. xxzhang@nefu.edu.cn FEBS letters 2015 Only protein-protein interactions imex curation imex curation trxm2_arath Thioredoxin M2, chloroplastic TRXM2 F9H3.15 T5L23.1 At4g03520 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAFTCTSRPPISLRSETRIVSSSPSASSLSSRRMFAVLPESSGLRIRLSLSPASLTSIHQPRVSRLRRAVVCEAQETTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFVGGEKKDTIIGAVPKTTLTSSLDKFLP vdac3_arath Mitochondrial outer membrane protein porin 3 VDAC3 HSR2 Protein HYPERSENSITIVE RESPONSE 2 Voltage-dependent anion-selective channel protein 3 F2G14.210 At5g15090 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQVKNNNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTSVGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLILNDKGEKLNASYYQIVSPSTVVGAEISHNFTTKENAITVGTQHALDPLTTVKARVNNAGVANALIQHEWRPKSFFTVSGEVDSKAIDKSAKVGIALALKP vdac3-trxm2_arath-1 1801297 N/A 1801301 unspecified role unspecified role prey prey cdna library cdna library N/A 1801302 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false nf vdac3-trxm2_arath-2 1801298 N/A 1801301 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A 1801302 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false f1a f1b 1-48 1801299 N/A 1801301 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1801302 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1c trxm2_arath-vdac3-1 1801300 N/A 1801301 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus-n venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1801302 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus-c venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1d