IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ liu-2015-5 in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa tag visualisation tag visualisation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer In some EMSAs a p65/p50 heterodimer was used and sometimes p65 alone - the reason for this is not stated. Figure 4D has probably been misidentified in the figure legend as an "RNA-Pulldown" whereas it is most likely an EMSA, due to the presence on the image of a "free-probe". Figure 4D image legend is identical to that shown for figure 4E -another RNA Pulldown. Results have been entered from figure 4D as an EMSA. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Cancer cell 2015 imex curation The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. Only protein-protein interactions liu-2015-4 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer p65 (RELA) has been entered with a GST tag and amino acids 1-306, as this is the only p65 recombinant protein on Sino Biological's web site. Reconbinant IKBA (Abcam) has been entered here without a His-tag, but it is possible the his-tagged protein was used throughout. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn Cancer cell 2015 imex curation The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. Only protein-protein interactions liu-2015-8 in vitro In vitro protein kinase assay protein kinase assay antibody detection identification by antibody antibody detection Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer It has been assumed that p65 is present in figures 6c and 6d. Phosphorylation of IκBα was detected by immunoblotting or ELISA. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Cancer cell 2015 imex curation The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. Only protein-protein interactions liu-2015-9 in vitro In vitro protein kinase assay protein kinase assay elisa enzyme linked immunosorbent assay ELISA ELISA elisa Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer Phosphorylation of IκBα was detected by immunoblotting or ELISA. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Cancer cell 2015 imex curation The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. Only protein-protein interactions liu-2015-3 human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells rna-ip rna immunoprecipitation rna-ip qrt-pcr quantitative reverse transcription pcr QRT-PCR Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer Results from Figure 5B have not been entered; these results are stated to show how point mutations of p65 (at the hairpin A -R33A, R35A, Y36A, and E39A or the hairpin B-binding site -K56A and K62A) disrupt interactions with NKILA - but no results from unmutated p65 are shown for comparison. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn Cancer cell 2015 imex curation Only protein-protein interactions liu-2015-11 in vitro In vitro enzymatic footprint enzymatic footprinting enzymatic footprint tag visualisation tag visualisation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Cancer cell 2015 imex curation The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. Only protein-protein interactions liu-2015-12 in vitro In vitro cleavage cleavage assay cleavage tag visualisation tag visualisation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Cancer cell 2015 imex curation The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. Only protein-protein interactions liu-2015-1 human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer songew@mail.sysu.edu.cn Cancer cell 2015 imex curation The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. Only protein-protein interactions liu-2015-6 in vitro In vitro footprinting footprinting ms participant Identification by mass spectrometry ms participant Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer Biotin-labeling Assay:Protein Footprinting exploits differential accessibility of the primary amine-modifying reagent N-hydroxysuccinimide (NHS)-biotin to lysine residues in the free protein versus the protein–RNA complex. Surface-exposed lysines are modified by NHS-biotin in free protein, while those coordinating RNA become shielded from modification in the nucleoprotein complex. Individual protein subunits are separated by SDS-PAGE followed by in-gel proteolysis, and subsequent MS analysis. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Cancer cell 2015 imex curation The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. Only protein-protein interactions liu-2015-10 in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift tag visualisation tag visualisation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Cancer cell 2015 imex curation The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. Only protein-protein interactions liu-2015-13 in vitro In vitro enzymatic footprint enzymatic footprinting enzymatic footprint qrt-pcr quantitative reverse transcription pcr QRT-PCR Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn Cancer cell 2015 imex curation Only protein-protein interactions liu-2015-2 human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer NKILA was detected by FISH -using an anti-NKILA oligodeoxynucleotide probe conjugated to Alexa Fluor 488. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. songew@mail.sysu.edu.cn Cancer cell 2015 imex curation The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. Only protein-protein interactions liu-2015-7 human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells rna-ip rna immunoprecipitation rna-ip qrt-pcr quantitative reverse transcription pcr QRT-PCR Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer Results from Figure 5B have not been entered; these results are stated to show how point mutations of p65 (at the hairpin A -R33A, R35A, Y36A, and E39A or the hairpin B-binding site -K56A and K62A) disrupt interactions with NKILA - but no results from unmutated p65 are shown for comparison. RIP-reRIP or Sequential RNA-IP; the bait for the first IP is taken as the prey for the second. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Cancer cell 2015 imex curation The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. Only protein-protein interactions q04206-1 Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 p65 RELA NFKB3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL nkila NKILA -LncRNA lncrna long non-coding ribonucleic acid lncRNA long non coding RNA long non coding ribonucleic acid long non-coding RNA lncrna human Homo sapiens Human AGACCCGGCACCCGCGCAACGGAGGAGGGGCGCTGTGCCCTCTCCCCAACGGCGGTCAGCTTGGAACGCCTGCCCGGCGCACGCCCGGGGCCGGGGAGCCGAACTCGGTGCCAGCCGCACCCGGGCGGGTTGCTGGTGCGCCCTCCCCTCGCCCCCGTCCCTGGGGTCCTTGACCCAGGCTCTTGGGGCTAGCCTATCTTCTGAGGAGCACAAGGTCCCTGGGGGCTCAGGGAAGAGAAATTGGAGAAAGGGGGAGGAAGCCCCCAAGATGGATCACCCATTGCCTGGTTTCGCAGGAGACTGTCCGCCTTCAGTTCTCCAGCAGCTCGGGGATCATGGCCCACTGAACCCCCAAGCGCTTTCACCCGAACCCAAGGAGGACGACCAGGAAAGACGGGAACTCGCGTAGACACGCCCGGAAGCCCTTGTCATGTAAATAGCTGTCGGGGACTGGTGTATTGTCGCCGCCCCAGCCGGCGGGACCTGGGGCGAATCCACACCCATTGTCTGCTGCCCAAGGGGCCTCCGGCTGGGGGGCGCGGCTGCGGAGTTCAAAAGGGGTATGAGCAGGAGGGGTGTACTTTTAGTTCATTAAGTTTTAATTACAGGAGTGCTACAAGAACACATTCTTCAGGTTTAAAAAGATATTAAAATATTACATAAGAGACCTCCCCTCCCTGGCCCACCTCCAGCCTCTTAAAAATTTAGTGTGTCGCCTTTTAGACACTTTCTCAAAGCTTCACTTATTTAACAGGCACTTAAGGAGCACCTACCTGTGCCAGAAACTCTCCAAATATTAACTCAACCTGACACCGACTCAGTGTGGCCGAATATTACTCTCCCCATTTTACAGAGCGGGCAGCTGGTCAAGGAAGTCGCTTGTTGAAAGTCACACAGTGGTGGAGCCTGTGTGCCAACCCAGGACCCTGGGGAGCTGCCTCCCCCTCTCCCACGTAGTCCTGATTCTTTAAGTGTCCACATATTCCTGTAATGCCTGGAGTTTCAGTAATTAGCAGGGACTTAGTGTGTTCAGAGAAAAAAAAAGCTTTTAAAAATTATTGTTACTGTGTTTGTAACAGTTTGGATAGAGAAGGAAAAGCTGGAATTTGGGAAGTGAAGGTGGCCTCGGGGTAGAACTTACCTAGACCAGAGCGAATTCATCCTGAAGAACTCAGAGAAAGCCGGTGCAGGAAGTGGGTTCCCGCTCTCCCTGCACAGGCACAGTGATGCTGCCAGAGCTCTCCCAGAAAGACCAGGAGGCTTGTTCTGGAGAAGTCAAGCCCAGGGATGTGGCTCAGGCTGGTCCAAGCTCTTTGGAGGAGTCCAAGCGTGCCCAGCCCAGAGGGAGGTTCAGAGGCACTGACCGTCTTCTGTTTGGGAGGAGAAGCTCACTCTTGGAGCCACAGCCAGCACTAGGTCAGGACCCAGGCCCCGGCCCAGGAGTGGGGCAATACCCAGCGTCTACCCCAGATGGCACCCTGCTGTGAACTGGGCGCCCTCAGCCCCTGCCTTGAGGAAGGGGCAATACCACCAGCGTGTCTTTTATCAGGGAAGATATTGCTGCAGTTTGGCCGCTGCAACTTAAGAGAAAAGCTAAGGGGTCCCCCAGCATCCCTTGGGGTGCCACTGCAAATACTGGCTGGGCCTGGAGATGACCTGGGTCCCATTCACTTCCTAGGGTGAAGGAGGTCATCATTACCACCCCTGCTTTCAGCCATTTCTTCATTCATTCAATCAACAAACTGGCTGAGCTGCAACCCTGAGCCGGGGAATTCAGCCACTCCAGACACAGCCCCTGCCCTCCGGGAAGTCTCGGGAGACCTGGCTAGTCTGGCTGGGAGAAGTCACACGTTGATTGTCTTGGAAGTGAGATGGCATTTACACAATGGAGGCTGCACTGCCAGCAGGCAAAAATAACCAGTTAATTCAGTGGCTTAAAGAAACCAAACCTACCCACAACGCTTGACCTCCCATTGATCCATCTGCGACACCGGCAGTGGCTACCATTTATTGAGTGCTGATGGTGTCACCTGGGATTGACTTAGTGGTCTCTGGCGCTAGTTCCGAAGTTGATTCTGTCTGGAGAGCTTAATGCAGTGTTCAGACCTCAGGGTCCGAACCTGAGGGTCACCCAAAGATGAGTGGGACATAGCTGTGTGACCTCGGCTGAGTGCTTTCACCTCTCCAACCTCAGTTTCCTCTTCTGCAAAATGGGGTGGCTTCATGGCACCTTCACGTGGTGTGATTGCGAGGAATGAAGGGATCGATGCCTTGCAAGTAGAGGAGAAGGGGCCGGATACATCTTAGTTGTTATGTTATTTAATCATCTTGGCAACCCCGGGAGGGAGGAACCACTATCATTTTATTTTCCATTTTGCAGTTGAGGACAATGATGATTCCAGCACAGACAGGGCCCCTGACGGGGCAGTAGGAAAGGAGAATTGCTTTGGAAGGAGCATAGGCTGGACTGCCAGCACTCATAGGAGGCTTCGTGTGTGCCCAGGACTGCGAGAATTAAATACAGGACACCCAGTTCAGTTTGAATTTCAGATAAACTATGAATAATGATTAGTGTAAGTATATCTCAATTTAACTGGAAAAAAAAAAAAAAAAAA p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 nkila_probe NKILA_promoter_probe lncrna long non-coding ribonucleic acid lncRNA long non coding RNA long non coding ribonucleic acid long non-coding RNA lncrna human Homo sapiens Human CGCGCGCTGCGCCAATCCCCGCCGAGGTTC canonical_nfkb_probe canonical_nfkb_probe lncrna long non-coding ribonucleic acid lncRNA long non coding RNA long non coding ribonucleic acid long non-coding RNA lncrna human Homo sapiens Human AGTTGAGGGGACTTTCCCAGGC q04864-2 Proto-oncogene c-Rel REL protein protein human Homo sapiens Human MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQV No experimental confirmation available. nkila_mutb nkila_deletion_mutant B lncrna long non-coding ribonucleic acid lncRNA long non coding RNA long non coding ribonucleic acid long non-coding RNA lncrna human Homo sapiens Human TGGTTTCGCAGGAGACTGTCCGCCTTCAGTTCTCCAGCAGCTCGGGGATCATGGCCCACTGAACCCCCAAGCGCTTTCACCCGAACCCAAGGAGGACGACCAGGAAAGACGGGAACTACACGCCCGGAAGCCCTTGTCATGTAAATAGCTGT tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS ikkb_human Inhibitor of nuclear factor kappa-B kinase subunit beta IKBKB IKKB I-kappa-B kinase 2 Nuclear factor NF-kappa-B inhibitor kinase beta Serine/threonine protein kinase IKBKB protein protein human Homo sapiens Human MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMALQTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQSFEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKIACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPEPAKKSEELVAEAHNLCTLLENAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS bay-117082 Bay-117082 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) wedelolactone wedelolactone 1,8,9-trihydroxy-3-methoxycoumestan Wedelolactone 1,8,9-trihydroxy-3-methoxy-6H-[1]benzofuro[3,2-c]chromen-6-one small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rnt1_aspor Guanyl-specific ribonuclease T1 rntA AO090011000118 protein protein aspor Aspergillus oryzae (strain ATCC 42149 / RIB 40) MMYSKLLTLTTLLLPTALALPSLVERACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT najox_rnase_v1 Cobra Venom RNASe V1 protein protein najox najox Central Asian cobra Oxus cobra rnas1_bovin Ribonuclease pancreatic RNASE1 RNS1 RNase 1 RNase A protein protein bovin Bos taurus (Bovine) Bovine MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV nkila_human_gene NKILA Human gene gene gene human Homo sapiens Human ikba_human_gene NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 gene gene human Homo sapiens Human nkila-nfkb1-7 1800659 N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800673 inhibitor inhibitor prey prey ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800675 unspecified role unspecified role prey prey physical association physical association false false false 4C nkila-nfkb1-8 1800659 N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800675 unspecified role unspecified role prey prey physical association physical association false false false 4C nkila-nfkb1-9 1800659 N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800673 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false c351g,g331c mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800675 unspecified role unspecified role prey prey physical association physical association false false false 4C (D) nkila-nfkb1-10 1800659 N/A 1800672 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false c351g,g331c mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800675 unspecified role unspecified role prey prey physical association physical association false false false 4C (4D) nkila-nfkb1-12 1800659 N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800676 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Supp 1E nkila_probe-rela-2 1800659 N/A 1800676 competitor competitor competitor prey prey in vitro In vitro N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800676 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Supp 1E-1 nkila_probe-nkila_probe-1 1800659 N/A 1800676 competitor competitor competitor prey prey c17g,c18g mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800676 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Supp 1E-2 nkila_probe-nkila_probe-2 1800659 N/A 1800677 competitor competitor competitor prey prey in vitro In vitro N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800676 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Supp 1E-3 nkila-rela-3 1800659 N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c351g,g331c mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Supp 4C nkila-rela-4 1800659 N/A 1800678 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 1800674 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false g331c,c351g mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Supp 4C-2 canonical_nfkb_probe-canonical_nfkb_probe-1 1800659 N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800677 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Supp 4Ei canonical_nfkb_probe-nkila-1 1800659 N/A 1800674 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800677 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Supp 4Eii The NK_286–444 probe competed more effectively for p65 than the DNA probe containing the consensus/canonical NFKB binding site. canonical_nfkb_probe-nkila-2 1800659 N/A 1800674 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800677 competitor competitor competitor prey prey in vitro In vitro direct interaction direct interaction false false false Supp 4F nkila-canonical_nfkb_probe-1 1800659 N/A 1800674 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Supp 4Fi canonical_nfkb_probe-canonical_nfkb_probe-2 1800659 N/A 1800677 competitor competitor competitor prey prey in vitro In vitro N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800677 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Supp 4Eiii The NK_286–444 probe competed more effectively for p65 than the DNA probe containing the consensus/canonical NFKB binding site. nkila-nkila-1 1800659 N/A 1800674 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800674 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Supp 4Fiii The NK_286–444 probe competed more effectively for p65 than the DNA probe containing the consensus/canonical NFKB binding site. nkila-nfkb1-14 1800659 N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800675 unspecified role unspecified role prey prey physical association physical association false false false 4D NKILA mutant B (deletion of nts 403-9) binds NF-kB alone, but binding is decreased in the presence of IKBA. nkila-nfkb1-15 1800659 N/A 1800673 inhibitor inhibitor prey prey ecoli Escherichia coli (strain K12) N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800675 unspecified role unspecified role prey prey physical association physical association false false false 4Di NKILA mutant B (deletion of nts 403-9) binds NF-kB alone, but binding is decreased in the presence of IKBA. nkila-rela-8 1800659 N/A 1800674 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind range range range range false in vitro In vitro N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c351g,g331c mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Supp 4Ci A "consensus" NFKB probe competed effectively. The exact sequence of this probe is not stated, but sequence of the NF-kB binding consensus sequences are given above Figure 4 and are:- nt 322–332 and nt 350–359 of NKILA. nkila-nfkb1-1 1800660 N/A 1800674 unspecified role unspecified role bait bait 3_prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800672 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3E, Supp 6E A mutation to disrupt hairpin C in NKILA did not reduce its binding to p65. nkila-nfkb1-2 1800660 N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800673 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c351g,g331c mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false 3_prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800675 unspecified role unspecified role prey prey physical association physical association false false false 3E,4A,4B/D/E, Supp 4H NKILA binds to p65, but only to p50 or IkBa in the presence of p65. q04206 is required for binding of P25963 to NR_131157.1 q04206 is required for binding of P19838-PRO_0000030311 to NR_131157.1 The NKILA mutant (mA) with two point mutations:- G331C and C351G disrupted this interaction. nkila-nfkb1-3 1800660 N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800675 unspecified role unspecified role prey prey physical association physical association false false false 3Ei,4B, Supp 4H nkila-nfkb1-4 1800660 N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800673 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 3Eii, Supp 6E A mutation to disrupt hairpin C in NKILA did not reduce its binding to p65. nkila-nfkb1-5 1800660 N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800673 inhibitor inhibitor prey prey ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800675 unspecified role unspecified role prey prey physical association physical association false false false 4Bi Mutants retaining only hairpin A, (NK322–359) and (NK286–402), bound to the p65:p50 heterodimer, as well as the p65 homodimer in the absence of IkBa, but not in the presence of IkBa. nkila-nfkb1-6 1800660 N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800673 inhibitor inhibitor prey prey ecoli Escherichia coli (strain K12) N/A 1800675 unspecified role unspecified role prey prey N/A 1800674 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 4Bii Mutants retaining only hairpin A, (NK322–359) and (NK286–402), bound to the p65:p50 heterodimer, as well as the p65 homodimer in the absence of IkBa, but not in the presence of IkBa. nkila-nfkb1-11 1800660 N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800675 unspecified role unspecified role prey prey N/A 1800679 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 4E, Supp 4H. A NKILA probe with a deletion of nucleotides 403-409 still bound to p65/p50 but in the presence of IKBA this binding was reduced. nkila-nfkb1-13 1800660 N/A 1800680 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells N/A 1800673 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells N/A 1800674 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800675 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells association association false false false Supp 3F p65 siRNA nfkbia-nkila-1 1800660 N/A 1800673 inhibitor inhibitor prey prey ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role bait bait 3_prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800678 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro direct interaction direct interaction false false false Supp 5C nkila-nfkbia-1 1800660 N/A 1800674 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800678 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro direct interaction direct interaction false false false Supp 5Ci ikbkb-nfkbia-10 1800661 N/A 1800681 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 1800673 enzyme target enzyme target substrate substrate neutral component neutral component ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 6A ikbkb-nfkbia-11 1800661 N/A 1800672 stimulator stimulator ancillary ancillary region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1800681 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 1800673 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 6Ai q04206-1 increases activity of O14920. ikbkb-nfkbia-12 1800661 N/A 1800681 enzyme enzyme neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 1800673 enzyme target enzyme target substrate substrate neutral component neutral component ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1800682 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) phosphorylation phosphorylation reaction phosphorylation false false false 6A-1 CHEBI:85928 inhibits activity of O14920. bay_117082-ikbkb-1 1800661 N/A 1800681 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 1800673 enzyme target enzyme target substrate substrate neutral component neutral component ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1800683 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) phosphorylation phosphorylation reaction phosphorylation false false false 6A-2 CHEBI:10037 inhibits activity of O14920. ikbkb-nfkbia-13 1800661 N/A 1800674 inhibitor inhibitor neutral component neutral component g331c,c351g mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800672 stimulator stimulator unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1800681 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 1800673 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 6Aii,6C/D The addition of NKILA to p65-prebound IkBa prior to active IKKb prevented in vitro IkBa phosphorylation, but adding NKILA after IKKb did not inhibit IkBa phosphorylation. A mutation to disrupt hairpin C in NKILA did not inhibit IKKb-induced IKBa phosphorylation. NR_131157 inhibits activity of O14920. NR_131157 decreases binding of O14920 to P25963 bay_117082-ikbkb-2 1800662 N/A 1800681 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 1800673 enzyme target enzyme target substrate substrate neutral component neutral component ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1800682 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) phosphorylation phosphorylation reaction phosphorylation false false false Supp 6A-1 ikbkb-nfkbia-14 1800662 N/A 1800681 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 1800673 enzyme target enzyme target substrate substrate neutral component neutral component ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1800683 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) phosphorylation phosphorylation reaction phosphorylation false false false Supp 6A-2 ikbkb-nfkbia-15 1800662 N/A 1800674 inhibitor inhibitor neutral component neutral component g331c,c351g mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800672 stimulator stimulator ancillary ancillary region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1800681 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 1800673 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) 1800982 1800977 phosphorylation phosphorylation reaction phosphorylation false false false Supp 6Aii The addition of NKILA to p65-prebound IkBa prior to active IKKb prevented in vitro IkBa phosphorylation, but adding NKILA after IKKb did not inhibit IkBa phosphorylation. ikbkb-nfkbia-16 1800662 N/A 1800681 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 1800673 enzyme target enzyme target substrate substrate neutral component neutral component ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Supp 6A ikbkb-nfkbia-17 1800662 N/A 1800672 unspecified role unspecified role ancillary ancillary region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1800681 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 1800673 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) 1800998 1800993 phosphorylation phosphorylation reaction phosphorylation false false false Supp 6Ai rela-nkila-2 1800663 N/A 1800674 unspecified role unspecified role prey prey N/A 1800680 unspecified role unspecified role bait bait association association false false false 3D, Supp 3E p65 siRNA nfkb1-nkila-1 1800663 N/A 1800674 unspecified role unspecified role prey prey N/A 1800675 unspecified role unspecified role bait bait association association false false false 3DI, Supp 3E p50 siRNA p65 siRNA nfkbia-nkila-3 1800663 N/A 1800674 unspecified role unspecified role prey prey N/A 1800673 unspecified role unspecified role bait bait association association false false false 3Dii, Supp 3E p65 siRNA IKBA siRNA rela-nkila-3 1800663 N/A 1800674 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false g331c,c351g mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false hairpin_A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1800680 unspecified role unspecified role bait bait association association false false false Supp 4D nkila-rela-5 1800664 N/A 1800674 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region range range range range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region range range range range false in vitro In vitro N/A 1800672 unspecified role unspecified role neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Supp 4G nkila-rela-6 1800664 N/A 1800674 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region range range range range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800678 unspecified role unspecified role neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro direct interaction direct interaction false false false Supp 5B nkila-rel-1 1800664 N/A 1800673 inhibitor inhibitor neutral component neutral component ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region range range range range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800678 unspecified role unspecified role neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro direct interaction direct interaction false false false Supp 5Bi nkila-rnta-2 1800665 N/A 1800684 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) N/A 1800674 enzyme target enzyme target substrate substrate neutral component neutral component 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro rna cleavage rna cleavage false false false Supp 6C RNase T1 specifically cleaves single-stranded RNA after guanosine residues. nkila-rnta-1 1800665 N/A 1800685 enzyme enzyme neutral component neutral component najox-venom najox-venom Central Asian cobra Oxus cobra venom venom N/A 1800674 enzyme target enzyme target substrate substrate neutral component neutral component 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro rna cleavage rna cleavage false false false Supp 6Ci RNase V1 cleaves double-stranded RNA in a non-sequence-specific manner najox_rnase_v1-nkila-1 1800665 N/A 1800686 enzyme enzyme neutral component neutral component bovin-pancreas Bovine pancreas pancreas N/A 1800674 enzyme target enzyme target substrate substrate neutral component neutral component 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro rna cleavage rna cleavage false false false Supp 6Cii RNase A is an endonuclease that specifically cleaves 3' of U and C residues. Acts on single-stranded and double-stranded RNA. rela-nkila_human_gene-2 1800666 N/A 1800680 unspecified role unspecified role bait bait N/A 1800687 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 1F TNF-alpha sc-3060 (CAS 213546-53-3) a small peptide inhibitor of NF-kB nuclear translocation. JSH-23 a small molecule inhibitor of NF-kB (p65) nuclear translocation. rela-nfkbia-3 1800666 N/A 1800680 unspecified role unspecified role bait bait N/A 1800688 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 1Fi TNF-alpha sc-3060 (CAS 213546-53-3) a small peptide inhibitor of NF-kB nuclear translocation. JSH-23 a small molecule inhibitor of NF-kB (p65) nuclear translocation. nkila-rela-1 1800667 N/A 1800674 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false g331c,c351g mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800680 unspecified role unspecified role neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1801070 1801065 direct interaction direct interaction false false false 5A, Supp 5A nkila-rela-2 1800667 N/A 1800674 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c351g,g331c mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 1800673 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800672 ancillary ancillary neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 6B, Supp 6F nkila_probe-rela-1 1800668 N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800676 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Supp 1E nkila_probe-rela-3 1800668 N/A 1800672 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro 1801094 1801091 direct interaction direct interaction false false false Supp 4C nkila-nfkbia-2 1800669 N/A 1800673 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1800674 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800672 unspecified role unspecified role neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro 1801099 1801097 direct interaction direct interaction false false false Supp 6D, Supp Table 7 nfkbia-nkila-2 1800669 N/A 1800674 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1800672 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro direct interaction direct interaction false false false Supp 6D, Supp Table 7i nkila-rela-7 1800670 N/A 1800680 unspecified role unspecified role neutral component neutral component N/A 1800674 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3C rela-nkila-1 1800671 N/A 1800673 unspecified role unspecified role prey prey N/A 1800674 unspecified role unspecified role prey prey in vitro In vitro N/A 1800680 unspecified role unspecified role bait bait Q04206:p.[Arg33Ala;Arg35Ala;Tyr36Ala;Glu39Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q04206:p.[Lys56Ala;Lys62Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false 5C