IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bender-2015-1 yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bender T., Pena G., Martinou JC., Bender T., Pena G., Martinou JC. jean-claude.martinou@unige.ch The EMBO journal 2015 Only protein-protein interactions imex curation imex curation Bender T., Pena G., Martinou JC., Bender T., Pena G., Martinou JC., Bender T., Pena G., Martinou JC., Bender T., Pena G., Martinou JC. bender-2015-2 yeast Saccharomyces cerevisiae Baker's yeast crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Bender T., Pena G., Martinou JC., Bender T., Pena G., Martinou JC. Cross-linker - disuccimidyl glutarate jean-claude.martinou@unige.ch The EMBO journal 2015 Only protein-protein interactions imex curation imex curation Bender T., Pena G., Martinou JC., Bender T., Pena G., Martinou JC., Bender T., Pena G., Martinou JC., Bender T., Pena G., Martinou JC. bender-2015-3 yeast Saccharomyces cerevisiae Baker's yeast bn-page blue native page bn-page anti tag western anti tag western blot anti tag western Bender T., Pena G., Martinou JC., Bender T., Pena G., Martinou JC. jean-claude.martinou@unige.ch The EMBO journal 2015 Only protein-protein interactions imex curation imex curation Bender T., Pena G., Martinou JC., Bender T., Pena G., Martinou JC., Bender T., Pena G., Martinou JC., Bender T., Pena G., Martinou JC. mpc2_yeast Mitochondrial pyruvate carrier 2 MPC2 YHR162W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTSSVRFAFRRFWQSETGPKTVHFWAPTLKWGLVFAGFSDMKRPVEKISGAQNLSLLSTALIWTRWSFVIKPRNILLASVNSFLCLTAGYQLGRIANYRIRNGDSISQLCSYILSGADESKKEITTGR 5C1FB3A463DE24A7 mpc1_yeast Mitochondrial pyruvate carrier 1 MPC1 FMP37 Protein FMP37 YGL080W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQPVQRAAARSFLQKYINKETLKYIFTTHFWGPVSNFGIPIAAIYDLKKDPTLISGPMTFALVTYSGVFMKYALSVSPKNYLLFGCHLINETAQLAQGYRFLKYTYFTTDEEKKALDKEWKEKEKTGKQ 1FD3A5BD176C247C mpc3_yeast Mitochondrial pyruvate carrier 3 MPC3 FMP43 Protein FMP43 G8620 YGR243W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSASAFNFAFRRFWNSETGPKTVHFWAPTLKWGLVFAGLNDIKRPVEKVSGAQNLSLLATALIWTRWSFVIKPKNYLLASVNFFLGCTAGYHLTRIANFRIRNGDSFKQVIHYIIKGETPAAVAAKQTASTSMNKGVIGTNPPITH E0B13933AB142B4E mpc2-mpc1-1 1882751 N/A 1882754 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1882755 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2D mpc3-mpc1-2 1882751 N/A 1882756 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1882755 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2D mpc2-mpc1-3 1882752 N/A 1882754 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 N/A 1882755 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false Fig. 2E mpc3-mpc1-1 1882752 N/A 1882756 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 N/A 1882755 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false Fig. 2F mpc1-mpc2-1 1882753 N/A 1882754 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1882755 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2C mpc1-mpc3-1 1882753 N/A 1882756 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1882755 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2C