UniProt UniProt http://www.uniprot.org tian-2014-1 arath-protoplast Arabidopsis thaliana protoplast Protoplast defined as a membrane-bound cell from which the outer wall has been partially or completely removed. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Tian W., Hou C., Ren Z., Pan Y., Jia J., Zhang H., Bai F., Zhang P., Zhu H., He Y., Luo S., Li L., Luan S. sllou@hnu.edu.cn Nature communications 2014 imex curation Only protein-protein interactions tian-2014-4 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Tian W., Hou C., Ren Z., Pan Y., Jia J., Zhang H., Bai F., Zhang P., Zhu H., He Y., Luo S., Li L., Luan S. sllou@hnu.edu.cn Nature communications 2014 imex curation Only protein-protein interactions tian-2014-2 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tian W., Hou C., Ren Z., Pan Y., Jia J., Zhang H., Bai F., Zhang P., Zhu H., He Y., Luo S., Li L., Luan S. sllou@hnu.edu.cn Nature communications 2014 imex curation Only protein-protein interactions tian-2014-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Tian W., Hou C., Ren Z., Pan Y., Jia J., Zhang H., Bai F., Zhang P., Zhu H., He Y., Luo S., Li L., Luan S. sllou@hnu.edu.cn Nature communications 2014 imex curation Only protein-protein interactions ht1_arath Serine/threonine/tyrosine-protein kinase HT1 HT1 High leaf temperature protein 1 SUU F24O1.13 At1g62400 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSGLCFNPFRLRWSLRSKLPLEPSLPNLPCNPSSSKTNRYAEAETMEKKRFDSMESWSMILESENVETWEASKGEREEWTADLSQLFIGNKFASGAHSRIYRGIYKQRAVAVKMVRIPTHKEETRAKLEQQFKSEVALLSRLFHPNIVQFIAACKKPPVYCIITEYMSQGNLRMYLNKKEPYSLSIETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLLNDEMRVKVADFGTSCLETQCREAKGNMGTYRWMAPEMIKEKPYTRKVDVYSFGIVLWELTTALLPFQGMTPVQAAFAVAEKNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAVLEKYDECVKEGLPLTSHASLTKTKKAILDHLKGCVTSISSPFSSSSVPVNA dtx56_arath Protein DETOXIFICATION 56 DTX56 Multidrug and toxic compound extrusion protein 56 Protein RESISTANT TO HIGH CARBON DIOXIDE 1 RHC1 T12H17.180 At4g22790 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSETSKSESLDPEVSEGLCSKTLMQSIVHELKLQMRIGLPLVVMNLLWFGKMTTTSVFLGRQGELNLAGGSLGFSFANVTGFSVLYGISAAMEPICGQAFGAKNFKLLHKTLFMAVLLLLLISVPISFLWLNVHKILTGFGQREDISFIAKKYLLYLLPELPILSFLCPLKAYLSSQGVTLPIMFTTAAATSLHIPINIVLSKARGIEGVAMAVWITDFIVVILLTGYVIVVERMKENKWKQGGWLNQSAQDWLTLIKLSGPCCLTVCLEWWCYEILVLLTGRLPNPVQAVSILIIVFNFDYLLYAVMLSLGTCVATRVSNELGANNPKGAYRAAYTTLIVGIISGCIGALVMIAFRGFWGSLYTHHDQLILNGVKKMMLIMAVIEVVNFPLMVCGEIVRGTAKPSLGMYANLSGFYLLALPLGATLAFKAKQGLQGFLIGLFVGISLCLSILLIFIARIDWEKEAGKAQILTCNTEDEQTSQGSGQDSHS bca4_arath Beta carbonic anhydrase 4 BCA4 CA4 Beta carbonate dehydratase 4 F17O7.5 At1g70410 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAPAFGKCFMFCCAKTSPEKDEMATESYEAAIKGLNDLLSTKADLGNVAAAKIKALTAELKELDSSNSDAIERIKTGFTQFKTEKYLKNSTLFNHLAKTQTPKFLVFACSDSRVCPSHILNFQPGEAFVVRNIANMVPPFDQKRHSGVGAAVEYAVVHLKVENILVIGHSCCGGIKGLMSIEDDAAPTQSDFIENWVKIGASARNKIKEEHKDLSYDDQCNKCEKEAVNVSLGNLLSYPFVRAEVVKNTLAIRGGHYNFVKGTFDLWELDFKTTPAFAFS srk2e_arath Serine/threonine-protein kinase SRK2E SNRK2.6 Serine/threonine-protein kinase OST1 Protein OPEN STOMATA 1 SNF1-related kinase 2.6 F17I5.140 SRK2E OST1 At4g33950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDRPAVSGPMDLPIMHDSDRYELVKDIGSGNFGVARLMRDKQSNELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCHRDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLMNDNTMTTQFDESDQPGQSIEEIMQIIAEATVPPAGTQNLNHYLTGSLDIDDDMEEDLESDLDDLDIDSSGEIVYAM slac1_arath Guard cell S-type anion channel SLAC1 SLAC1 CDI3 OZS1 RCD3 F5O11.23 T12C24.3 At1g12480 Protein CARBON DIOXIDE INSENSITIVE 3 Protein OZONE-SENSITIVE 1 Protein RADICAL-INDUCED CELL DEATH 3 Protein SLOW ANION CHANNEL-ASSOCIATED 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERKQSNAHSTFADINEVEDEAEQELQQQENNNNKRFSGNRGPNRGKQRPFRGFSRQVSLETGFSVLNRESRERDDKKSLPRSGRSFGGFESGGIINGGDGRKTDFSMFRTKSTLSKQKSLLPSIIRERDIENSLRTEDGETKDDSINENVSAGRYFAALRGPELDEVKDNEDILLPKEEQWPFLLRFPIGCFGICLGLSSQAVLWLALAKSPATNFLHITPLINLVVWLFSLVVLVSVSFTYILKCIFYFEAVKREYFHPVRVNFFFAPWVVCMFLAISVPPMFSPNRKYLHPAIWCVFMGPYFFLELKIYGQWLSGGKRRLCKVANPSSHLSVVGNFVGAILASKVGWDEVAKFLWAVGFAHYLVVFVTLYQRLPTSEALPKELHPVYSMFIAAPSAASIAWNTIYGQFDGCSRTCFFIALFLYISLVARINFFTGFKFSVAWWSYTFPMTTASVATIKYAEAVPGYPSRALALTLSFISTAMVCVLFVSTLLHAFVWQTLFPNDLAIAITKRKLTREKKPFKRAYDLKRWTKQALAKKISAEKDFEAEEESHH rhc1-ht1-1 1860961 N/A 1860965 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1860966 unspecified role unspecified role neutral component neutral component region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2a rhc1-ca4-1 1860961 N/A 1860967 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1860966 unspecified role unspecified role neutral component neutral component region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2a ht1-ost1-1 1860961 N/A 1860965 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1860968 unspecified role unspecified role neutral component neutral component region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4a ht1-ost1-2 1860962 N/A 1860968 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 1860965 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Fig. 4b ost1-slac1-1 1860962 N/A 1860968 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 1860969 enzyme target enzyme target substrate substrate unspecified role unspecified role N-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Fig. 4b rhc1-ca4-2 1860963 N/A 1860967 unspecified role unspecified role unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860966 unspecified role unspecified role unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 2b rhc1-ht1-2 1860964 N/A 1860965 unspecified role unspecified role prey prey N-terminal nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1860966 unspecified role unspecified role bait bait N-terminal cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 2c