MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint arutyunova-2014-1 Allosteric regulation of rhomboid intramembrane proteolysis. in vitro In vitro enzymatic study enzymatic study western blot western blot Immuno blot Immuno blot Arutyunova E., Panwar P., Skiba P.M., Gale N., Mak M.W., Lemieux M.J. joanne.lemieux@ualberta.ca EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation arutyunova-2014-3 Allosteric regulation of rhomboid intramembrane proteolysis. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Arutyunova E., Panwar P., Skiba P.M., Gale N., Mak M.W., Lemieux M.J. joanne.lemieux@ualberta.ca EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation arutyunova-2014-2 Allosteric regulation of rhomboid intramembrane proteolysis. in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Arutyunova E., Panwar P., Skiba P.M., Gale N., Mak M.W., Lemieux M.J. joanne.lemieux@ualberta.ca EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation arutyunova-2014-4 Allosteric regulation of rhomboid intramembrane proteolysis. in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Arutyunova E., Panwar P., Skiba P.M., Gale N., Mak M.W., Lemieux M.J. joanne.lemieux@ualberta.ca EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation aara_prost Rhomboid protease AarA aarA Intramembrane serine protease protein protein prost Providencia stuartii MAEQQNPFSIKSKARFSLGAIALTLTLVLLNIAVYFYQIVFASPLDSRESNLILFGANIYQLSLTGDWWRYPISMMLHSNGTHLAFNCLALFVIGIGCERAYGKFKLLAIYIISGIGAALFSAYWQYYEISNSDLWTDSTVYITIGVGASGAIMGIAAASVIYLIKVVINKPNPHPVIQRRQKYQLYNLIAMIALTLINGLQSGVDNAAHIGGAIIGALISIAYILVPHKLRVANLCITVIAASLLTMMIYLYSFSTNKHLLEEREFIYQEVYTELADANQ a1yh68_prost Sec-independent protein translocase protein TatA tatA NCTC12257_03922 protein protein prost Providencia stuartii MESTIATAAFGSPWQLIIIALLIILIFGTKKLRSLGSDLGESLKGFKKAMNDDEAAKAAKEEQEKQDADFAPKNITEQQQAADKKDSPVESKNKEQG glpg_ecoli Rhomboid protease GlpG Intramembrane serine protease JW5687 b3424 glpG protein protein ecoli Escherichia coli (strain K12) MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPADPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK glpg_haein Rhomboid protease GlpG glpG Intramembrane serine protease HI_0618 protein protein haein Haemophilus influenzae MKNFLAQQGKITLILTALCVLIYLAQQLGFEDDIMYLMHYPAYEEQDSEVWRYISHTLVHLSNLHILFNLSWFFIFGGMIERTFGSVKLLMLYVVASAITGYVQNYVSGPAFFGLSGVVYAVLGYVFIRDKLNHHLFDLPEGFFTMLLVGIALGFISPLFGVEMGNAAHISGLIVGLIWGFIDSKLRKNSLE aara-tata 1776050 n/a 1776054 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Stoichiometry: 2.0 n/a 1776055 western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage false false false f1b f1c t1 sf1 f4f sf4a For all three rhomboids, we observed a loss of activity in the presence of DM, at conditions where the protein exists as a monomer. For AarA, purified in DDM, only 50% of activity was observed in DM reaction buffer, consistent with the gel filtration results, showing only partial dissociation. A full loss of activity for AarA was observed only when DM was used in both Ni-NTA purification and the activity assay. aara-tata-1 1776050 n/a 1776056 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Stoichiometry: 2.0 n/a 1776055 western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage false false false f1b f1c t1 sf1 f4e sf4b For all three rhomboids, we observed a loss of activity in the presence of DM, at conditions where the protein exists as a monomer. For AarA, purified in DDM, only 50% of activity was observed in DM reaction buffer, consistent with the gel filtration results, showing only partial dissociation. A full loss of activity for AarA was observed only when DM was used in both Ni-NTA purification and the activity assay. glpg-tata 1776050 n/a 1776055 western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component purified purified Stoichiometry: 2.0 n/a 1776057 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified cleavage cleavage reaction cleavage false false false f1b f1c t1 f4d sf4c For all three rhomboids, we observed a loss of activity in the presence of DM, at conditions where the protein exists as a monomer. For AarA, purified in DDM, only 50% of activity was observed in DM reaction buffer, consistent with the gel filtration results, showing only partial dissociation. A full loss of activity for AarA was observed only when DM was used in both Ni-NTA purification and the activity assay. aara-tata-3 1776051 n/a 1776054 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false f4c aara-4 1776051 n/a 1776056 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false f4b glpg-1 1776051 n/a 1776057 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false f4a sf5a aara-tata-2 1776052 n/a 1776054 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified P46116:p.Phe105Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 1776055 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified ypet yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false cypet cyanine label cyanine label n-term range n-terminal range n-term range n-term range n-terminal range n-term range false cleavage cleavage reaction cleavage false false false f2b f2c t2 glpg-1 1776053 n/a 1776057 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false sf5c