MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint garg-2014-1 Tpz1TPP1 SUMOylation reveals evolutionary conservation of SUMO-dependent Stn1 telomere association. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Garg M., Gurung R.L., Mansoubi S., Ahmed J.O., Davé A., Watts F.Z., Bianchi A. A.Bianchi@sussex.ac.uk EMBO Rep. (1469-221X) 2014 Only protein-protein interactions imex curation stn1_schpo Protein stn1 stn1 SPBC409.12c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLENENQLTHQFPTLSRWNPMFISDVHKISFHPHLQRYIGFWMGFPIRWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMSKRAISMSPGNVVCVFGKINSFRSEVELIAQSFEELRDPNDEWKAWQKRMRYKKNLTKISKNHHSIIRTPKKSYFPKDHAKELLKCIRQMCKLNVQAGFTIEELIIYLKAKELHLPLVHIFNVENEIVENCDGNHILALNFSLQTLLQHGRIVRKSNSVYMLVTSKDIIRFVIPLMASGLLEAHKVQSIVRDSNPMFITLPLSAIAKHICQFLLRTKGKWRQAKKYTWVRDNQFV pmt3_schpo Ubiquitin-like protein pmt3/smt3 pmt3 smt3 ubl2 SPBC365.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSESPSANISDADKSAITPTTGDTSQQDVKPSTEHINLKVVGQDNNEVFFKIKKTTEFSKLMKIYCARQGKSMNSLRFLVDGERIRPDQTPAELDMEDGDQIEAVLEQLGGCTHLCL ten1_schpo Protein ten1 ten1 SPCC1393.14 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDSAKLIFINQINDCKDGQKLRFLGCVQSYKNGILRLIDGSSSVTCDVTVVLPDVSIQKHEWLNIVGRKRQDGIVDVLLIRSAVGINLPRYRQMVSERQKCD tpz1_schpo Protection of telomeres protein tpz1 tpz1 mug169 Meiotically up-regulated gene 169 protein SPAC6F6.16c SPAC6F6.18c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSNCLKHPWLENGLLNLIKNADVLPIRVFKCQPLQIFEYIRYEHPIRCKLSDTEFYIEAEFSSQSISDLNNFTEKRITSLRGGIVTLGNFLIHLIPSQSGIIPWIQVESFNFQGCEGAVFGNPKAITTSALFNALLQSPYLAALANEFNRSIKEGSSYQEASLSQQEKPNDNTSNSRDIKNNIQFHWKNMTSLSIEECIIPKGQQLILEKESEENTTHGIYLEERKMAQGLHNSVSETPEVKQEDNDEDLDAYSWSSSTDSAGEIPSLPTNRKILEKIAEKPPPFESPLEDDETPDQTNEHEANQVNVSQLPLNPRGSGISGRPVESTEQLNSSLTIERSQSIQSTDSKQRVETQSHRRSKIEIFDAQDELFDRSICTTIDDSTGKLLNAEETPIKTGDLHSTSASSVISCTPPAINFTSDICNEQIELEYKRKPIPDYDFMKGLETTLQELYVEHQSKKRRLELFQLTNNHQKNSEACEMCRLGLPHGSFFELLRDWKKIEEFRNKS A1A2F59238DACBF7 pmt3-stn1 1773968 n/a 1773969 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell n/a 1773970 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false f4a stn1-pmt3 1773968 n/a 1773970 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell n/a 1773971 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false f4a stn1-pmt3-1 1773968 n/a 1773969 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell n/a 1773972 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f4aa