matrixdb Institut de Biologie et de Chimie des Prot\u00c3\u00a9ines, 7, passage du Vercors 69 367 Lyon cedex 07 FRANCE matrixdb@ibcp.fr http://matrixdb.ibcp.fr Institut de Biologie et de Chimie des Prot\u00c3\u00a9ines, 7, passage du Vercors 69 367 Lyon cedex 07 FRANCE http://matrixdb.ibcp.fr kim-2014-7 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim BR., Dong SM., Seo SH., Lee JH., Lee JM., Lee SH., Rho SB. sbrho@ncc.re.kr Cellular signalling 2014 Only protein-protein interactions imex curation imex curation kim-2014-5 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Kim BR., Dong SM., Seo SH., Lee JH., Lee JM., Lee SH., Rho SB. sbrho@ncc.re.kr Cellular signalling 2014 Only protein-protein interactions imex curation imex curation kim-2014-6 human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim BR., Dong SM., Seo SH., Lee JH., Lee JM., Lee SH., Rho SB. sbrho@ncc.re.kr Cellular signalling 2014 Only protein-protein interactions imex curation imex curation loxl2_human Lysyl oxidase homolog 2 LOXL2 Lysyl oxidase-like protein 2 Lysyl oxidase-related protein 2 Lysyl oxidase-related protein WS9-14 protein protein human Homo sapiens Human MERPLCSHLCSCLAMLALLSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRLAGQKRKHSEGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGPIWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLNIQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQICDKHWTAKNSRVVCGMFGFPGERTYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLPAVVSCVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSASVVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDAGVRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWGIVEAMVVCRQLGLGFASNAFQETWYWHGDVNSNKVVMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAGVACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLEDTECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ mint mrp_human MARCKS-related protein MARCKSL1 MLP MRP MARCKS-like protein 1 Macrophage myristoylated alanine-rich C kinase substrate protein protein human Homo sapiens Human MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE loxl2-marcksl1-3 1791104 N/A 1791107 unspecified role unspecified role bait bait N/A 1791108 unspecified role unspecified role prey prey physical association physical association false false false Figure 1D loxl2-marcksl1-4 1791104 N/A 1791107 unspecified role unspecified role prey prey N/A 1791108 unspecified role unspecified role bait bait physical association physical association false false false Figure 1D loxl2-marcksl1-1 1791105 N/A 1791107 unspecified role unspecified role bait bait binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1791108 unspecified role unspecified role prey prey binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1B, Figure 2A, 2B, 2C loxl2-marcksl1-2 1791106 N/A 1791107 unspecified role unspecified role bait bait tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1791108 unspecified role unspecified role prey prey physical association physical association false false false Figure 1C