UniProt UniProt http://www.uniprot.org lu-2013-3 mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z., Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z. Origin of used constructs has been confirmed by the authors by e-mail zhenyu.yue@mssm.edu Nature communications 2013 Only protein-protein interactions imex curation IMEx imex curation lu-2013-11 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z., Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z. Origin of used constructs has been confirmed by the authors by e-mail zhenyu.yue@mssm.edu Nature communications 2013 Only protein-protein interactions imex curation IMEx imex curation lu-2013-10 mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z., Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z. Wildtype MEFs or NRBF2 KO MEFs transfected (or not) with NRBF2 mutant constructs have been used Origin of used constructs has been confirmed by the authors by e-mail zhenyu.yue@mssm.edu Nature communications 2013 Only protein-protein interactions imex curation IMEx imex curation lu-2013-2 mouse-brain Mus musculus brain brain Brain [cerebrum] anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z., Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z. Rescued Becn1-/-; Becn1(EGFP+) mice have been used Origin of used constructs has been confirmed by the authors by e-mail zhenyu.yue@mssm.edu Nature communications 2013 Only protein-protein interactions imex curation IMEx imex curation lu-2013-4 mouse-brain Mus musculus brain brain Brain [cerebrum] molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z., Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z. Origin of used constructs has been confirmed by the authors by e-mail zhenyu.yue@mssm.edu Nature communications 2013 Only protein-protein interactions imex curation IMEx imex curation lu-2013-5 mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z., Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z. Origin of used constructs has been confirmed by the authors by e-mail zhenyu.yue@mssm.edu Nature communications 2013 Only protein-protein interactions imex curation IMEx imex curation lu-2013-6 in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z., Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z. Origin of used constructs has been confirmed by the authors by e-mail zhenyu.yue@mssm.edu Nature communications 2013 Only protein-protein interactions imex curation IMEx imex curation lu-2013-7 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z., Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z. Origin of used constructs has been confirmed by the authors by e-mail zhenyu.yue@mssm.edu Nature communications 2013 Only protein-protein interactions imex curation IMEx imex curation lu-2013-8 mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells confocal microscopy confocal microscopy immunostaining immunostaining Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z., Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z. Starvation conditions Origin of used constructs has been confirmed by the authors by e-mail zhenyu.yue@mssm.edu Nature communications 2013 Only protein-protein interactions imex curation IMEx imex curation lu-2013-9 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z., Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z. Origin of used constructs has been confirmed by the authors by e-mail zhenyu.yue@mssm.edu Nature communications 2013 Only protein-protein interactions imex curation IMEx imex curation lu-2013-12 mouse-liver Mus musculus liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z., Lu J., He L., Behrends C., Araki M., Araki K., Jun Wang Q., Catanzaro JM., Friedman SL., Zong WX., Fiel MI., Li M., Yue Z. Origin of used constructs has been confirmed by the authors by e-mail zhenyu.yue@mssm.edu Nature communications 2013 Only protein-protein interactions imex curation imex curation nrbf2_mouse Nuclear receptor-binding factor 2 Nrbf2 protein protein mouse Mus musculus Mouse MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAHLSLELQRDSHMKQLLLIQERWKRAKREERLKAQQSTERDGAPHLQAPPRPSEDAEGQSPLLSQPYIPSTERRLPEVQGVFDRDPDTLLFLLQQKNEPSEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGTAEKELDVDADFVEKSELWGLPSHSESAAASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMND becn1_mouse Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Becn1 protein protein mouse Mus musculus Mouse MEGSKASSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEEANSGEEPFIETRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQRELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQVRYAQIQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK bakor_mouse Beclin 1-associated autophagy-related key regulator Atg14 D14Ertd436e Kiaa0831 Autophagy-related protein 14-like protein Atg14L protein protein mouse Mus musculus Mouse MASPSGKGSWTPEAPGFGPRALARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQSGDFVYFDGRDRERFIDKKERLSQLKNKQEEFQKEVLKAMEGKRLTDQLRWKIMSCKMRIEQLKQTICKGNEEMKKNSEGLLKNKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLKSHYERLARLRRSHILELTSIIFPIDEVKTSGRDPADVSSETDSAMTSSMVSKLAEARRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYNWVEEKKTTQGPDMEHNNPAYTISAALGYATQLVNIVSHILDINLPKKLCNSEFCGENLSKQKLTRAVRKLNANILYLCSSQHVNLDQLQPLHTLRNLMHLVSPRSEHLGRSGPFEVRADLEESMEFVDPGVAGESDASGDERVSDEETDLGTDWENLPSPRFCDIPSQPVEVSQSQSTQVSPPIASSSAGGMISSAAASVTSWFKAYTGHR uvrag_mouse UV radiation resistance-associated protein Uvrag1 Uvrag protein protein mouse Mus musculus Mouse MSSCASLGGPVPLPPPGPSAALTSGAPARALHVELPSQQRRLRHLRNIAARNIVNRNGHQLLDTYFTLHLCDNEKIFKEFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGGKEEAFQLLIEWKVYLDGLKYLGQQIHARNQNEIIFGLNDGYYGAPCEHKGHPNAQKNLLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQRLGKEIEEKLRLTSTSNELKKESECLRLKILVLRNELERQKKALGREVAFLHKQQMALQDKGSAFSTEHGKLQLQKDSLSELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNENKDYFVCGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNKNIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHISNAIPVPKRQSSTFGGADGGFSAGIPSPDKVHRKRASSENERLQYKTPPPSYNSALTQPGVAMPTSGDSERKVAPLSSSLDTSLDFSKENKKAGVDLGSSVSGDHGNSDSGQEQGEALPGHLAAVNGTALPSEQAGPAGTLLPGSCHPAPSAELCCAVEQAEEIIGLEATGFTSGDQLEALSCIPVDSAVAVECDEQVLGEFEEFSRRIYALSENVSSFRRPRRSSDK pk3c3_mouse Phosphatidylinositol 3-kinase catalytic subunit type 3 Vps34 Pik3c3 Phosphoinositide-3-kinase class 3 protein protein mouse Mus musculus Mouse MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGSAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTRTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNATTRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQTSASESLSNSGVSSGDIDSSQIITNPLPPVASPPPASKAKEVSDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSETGPYGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK pi3r4_mouse Phosphoinositide 3-kinase regulatory subunit 4 Vps15 Pik3r4 protein protein mouse Mus musculus Mouse MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDPTLPLTSYKQELEELKIRLHSAQNCLPFQKAAEKASEKAAMLFRQYVRDNLYDRISTRPFLNNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNPADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRARGELKRAMDIFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKIEDRSIRDLVTQMINREPEKRLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGHDLPEKAEGESRASGLVVLVSVITSCLQTLKSCDSKLAALELILHLAPRLSVEILLDRITPYLLHFSNDSVPRVRAEALRTLTKVLALVQEVPRNDVNIYPEYILPGIAHLAQDDATIVRLAYAENIALLAETALRFLELVQLKTLNMENEPDNEEVDEATRPNGDYDTELQALHEMVQQKVVTLLSDPENIVKQTLMESGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDSIVGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKALNALTCMCQLGLLQKPHVYEFASDIAPFLCHPNLWIRYGAVGFITVVAHQISTADVYCKLMPYLDPYITQPVIQIERKLVLLSVLKEPVSRSIFDYALRSKDIASLFRHLHMRQKKRNGSLLDCPPPEDPTIAQLLKKLLSQGMTEEEEDKLLALKDFMMKSNRAKANAVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEPDEKRARKHVKQDSNVNEEWKSMFGSLEPPNIPQALPKTSDHEVVQPGKPPRSESSAGICVPLSTSPQVSEAAHIPSKKPVIPVVSSTVLPSTYQIRITTCKTELQQLIQQKREQCNAERIAKQMMENAEWESKPPPPGWRPKGLLVAHLHEHKSAVNRIRVSDEHLLFATCSNDGTVKIWNSQKMEGKTTTTRSILTYSRIGGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSPKIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLKSGLITSFAVDIHQCWLCIGTSSGAMACWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWVIAAVQGNNEVSMWDMETGDRRLTLWASSAPPLSELQPSPHSVHGIYCSPADGNPILLTAGSDMKIRFWDLVSPERSYVVAGSTGSPSVSYYKKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDIATFQTTQGFIVTASRDGIVKVWK pk3c3_human Phosphatidylinositol 3-kinase catalytic subunit type 3 PIK3C3 Phosphoinositide-3-kinase class 3 Phosphatidylinositol 3-kinase p100 subunit VPS34 hVps34 protein protein human Homo sapiens Human MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK uvrag_human UV radiation resistance-associated gene protein UVRAG p63 protein protein human Homo sapiens Human MSASASVGGPVPQPPPGPAAALPPGSAARALHVELPSQQRRLRHLRNIAARNIVNRNGHQLLDTYFTLHLCSTEKIYKEFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGGKENIYQLLIEWKVCLDGLKYLGQQIHARNQNEIIFGLNDGYYGAPFEHKGYSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKEIEEKLRLTSTSNELKKKSECLQLKILVLQNELERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFVCGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNKNIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSENERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLLPSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFRRPRRSSDK pi3r4_human Phosphoinositide 3-kinase regulatory subunit 4 PI3-kinase p150 subunit Phosphoinositide 3-kinase adaptor protein PIK3R4 VPS15 protein protein human Homo sapiens Human MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDPTLPLTSYKQELEELKIRLNSAQNCLPFQKASEKASEKAAMLFRQYVRDNLYDRISTRPFLNNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNPADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRTRGELKRAMDIFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKIEDHSIRELVTQMIHREPDKRLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGHDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRLSVEILLDRITPYLLHFSNDSVPRVRAEALRTLTKVLALVKEVPRNDINIYPEYILPGIAHLAQDDATIVRLAYAENIALLAETALRFLELVQLKNLNMENDPNNEEIDEVTHPNGNYDTELQALHEMVQQKVVTLLSDPENIVKQTLMENGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDSIVGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKALYALTCMCQLGLLQKPHVYEFASDIAPFLCHPNLWIRYGAVGFITVVARQISTADVYCKLMPYLDPYITQPIIQIERKLVLLSVLKEPVSRSIFDYALRSKDITSLFRHLHMRQKKRNGSLPDCPPPEDPAIAQLLKKLLSQGMTEEEEDKLLALKDFMMKSNKAKANIVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEPDDKRARKHVKQDSNVNEEWKSMFGSLDPPNMPQALPKGSDQEVIQTGKPPRSESSAGICVPLSTSSQVPEVTTVQNKKPVIPVLSSTILPSTYQIRITTCKTELQQLIQQKREQCNAERIAKQMMENAEWESKPPPPGWRPKGLLVAHLHEHKSAVNRIRVSDEHSLFATCSNDGTVKIWNSQKMEGKTTTTRSILTYSRIGGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSPKIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLKSGLITSFAVDIHQCWLCIGTSSGTMACWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWVIAAVQGNNEVSMWDMETGDRRFTLWASSAPPLSELQPSPHSVHGIYCSPADGNPILLTAGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK rubic_mouse Run domain Beclin-1-interacting and cysteine-rich domain-containing protein Rubcn Kiaa0226 protein protein mouse Mus musculus Mouse MRPEGAGMDLGGGDGERLLEKSRREHWQLLGNLKTTVEGLVSANCPNVWSKYGGLERLCRDMQNILYHGLIHDQVCCRQADYWQFVKDIRWLSPHSALHVEKFISLHESDQSDTDSVSERAVAELWLQHSLQCHCLSAQLRPLLGDRQYIRKFYTETAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKQESPLLVTKSQSLTALPGSTYTPPASYAQHSYFGSSSSLQSMPQSSHSSERRSTSFSLSGPSWQPQEDRECLSPAETQTTPAPLPSDSTLAQDSPLTAQEMSDSTLTSPLEASWVSSQNDSPSDVSEGPEYLAIGNPAPHGRTASCESHSSNGESSSSHLFSSSSSQKLESAASSLGDQEEGRQSQAGSVLRRSSFSEGQTAPVASGTKKSHIRSHSDTNIASRGAAGGPRNITIIVEDPIAEGGQYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLEKENAHFSISESLIAAIELMKCNMMSQCLEEEEVEEEDSDREIQELKQKIRLRRQQIRTKNLLPAYRETENGSFRVTSSSSQFSSRDSTQLSESGSAEDADDLEIQDADIRRSAVSNGKSSFSQNLSHCFLHSTSAEAVAMGLLKQFEGMQLPAASELEWLVPEHDAPQKLLPIPDSLPISPDDGQHADIYKLRIRVRGNLEWAPPRPQIIFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYIKRLRYCEYLGKYFCQCCHENAQMVVPSRILRKWDFSKYYVSNFSKDLLLKIWNDPLFNVQDINSALYRKVKLLNQVRLLRVQLYHMKNMFKTCRLAKELLDSFDVVPGHLTEDLHLYSLSDLTATKKGELGPRLAELTRAGAAHVERCMLCQAKGFICEFCQNEEDVIFPFELHKCRTCEECKACYHKTCFKSGRCPRCERLQARRELLAKQSLESYLSDYEEEPTEALALEATVLETT nrbf2_human Nuclear receptor-binding factor 2 NRBF2 COPR Comodulator of PPAR and RXR protein protein human Homo sapiens Human MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK bakor_human Beclin 1-associated autophagy-related key regulator KIAA0831 Autophagy-related protein 14-like protein ATG14 ATG14L protein protein human Homo sapiens Human MASPSGKGARALEAPGCGPRPLARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQSGDFVYFDGRDRERFIDKKERLSRLKSKQEEFQKEVLKAMEGKWITDQLRWKIMSCKMRIEQLKQTICKGNEEMEKNSEGLLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLRSHYERLANLRRSHILELTSVIFPIEEVKTGVRDPADVSSESDSAMTSSTVSKLAEARRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYSWVEEKKTTQGPDMEQSNPAYTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGENLSKQKFTRAVKKLNANILYLCFSQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESMEFVDPGVAGESDESGDERVSDEETDLGTDWENLPSPRFCDIPSQSVEVSQSQSTQASPPIASSSAGGMISSAAASVTSWFKAYTGHR becn1-nrbf2-1 1799459 N/A 1799470 unspecified role unspecified role prey prey N/A 1799471 unspecified role unspecified role bait bait physical association physical association false false false 1b nrbf2-becn1-1 1799459 N/A 1799470 unspecified role unspecified role bait bait N/A 1799471 unspecified role unspecified role prey prey physical association physical association false false false 1b nrbf2-atg14-1 1799459 N/A 1799470 unspecified role unspecified role bait bait N/A 1799472 unspecified role unspecified role prey prey N/A 1799471 unspecified role unspecified role prey prey n/a 1799473 unspecified role unspecified role prey prey N/A 1799474 unspecified role unspecified role prey prey N/A 1799475 unspecified role unspecified role prey prey association association false false false 1c pik3c3-atg14-4 1799459 N/A 1799470 unspecified role unspecified role prey prey N/A 1799472 unspecified role unspecified role prey prey N/A 1799471 unspecified role unspecified role prey prey N/A 1799473 unspecified role unspecified role prey prey N/A 1799475 unspecified role unspecified role prey prey N/A 1799474 unspecified role unspecified role bait bait association association false false false 8A atg14-becn1-14 1799459 N/A 1799470 unspecified role unspecified role prey prey N/A 1799472 unspecified role unspecified role bait bait N/A 1799471 unspecified role unspecified role prey prey N/A 1799475 unspecified role unspecified role prey prey N/A 1799474 unspecified role unspecified role prey prey association association false false false 8A Association of VPS15 and VPS34 is decreased in Nrbf2 KO mice atg14-pik3c3-1 1799460 N/A 1799470 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1799476 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1799472 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 2d NRBF2 cotransfection increases lipid kinase activity of the precipitate uvrag-pik3c3-1 1799460 N/A 1799477 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1799470 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1799476 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4d NRBF2 cotransfection increases lipid kinase activity of the precipitate pik3c3-nrbf2-1 1799460 N/A 1799470 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1799476 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1799478 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 8d NRBF2 cotransfection increases lipid kinase activity of the precipitate atg14-becn1-12 1799461 N/A 1799470 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 1799471 unspecified role unspecified role prey prey N/A 1799474 unspecified role unspecified role prey prey N/A 1799475 unspecified role unspecified role prey prey N/A 1799472 unspecified role unspecified role bait bait association association false false false 2b In mock-transfected NRBF2 KO MEFS no Vps15/Pik3r4 and no lipid kinase activity of the precipitate detected atg14-becn1-13 1799461 N/A 1799471 unspecified role unspecified role prey prey N/A 1799474 unspecified role unspecified role prey prey N/A 1799475 unspecified role unspecified role prey prey N/A 1799472 unspecified role unspecified role bait bait association association false false false 2b in wildtype MEFs becn1-atg14-7 1799462 N/A 1799470 unspecified role unspecified role prey prey N/A 1799472 unspecified role unspecified role prey prey N/A 1799471 unspecified role unspecified role bait bait nucl transformation nucleic acid transformation nucl transformation region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1799473 unspecified role unspecified role prey prey N/A 1799475 unspecified role unspecified role prey prey N/A 1799474 unspecified role unspecified role prey prey N/A 1799479 unspecified role unspecified role prey prey association association false false false 1a atg14-becn1-10 1799463 N/A 1799470 unspecified role unspecified role neutral component neutral component N/A 1799472 unspecified role unspecified role neutral component neutral component N/A 1799471 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1d becn1-atg14-8 1799464 N/A 1799470 unspecified role unspecified role prey prey N/A 1799472 unspecified role unspecified role prey prey N/A 1799471 unspecified role unspecified role bait bait association association false false false 1e Association not affected by Nrbf2 knockdown (RNAi). ATG14L KO decreased the interaction between becn1 and nrbf2 nrbf2-atg14-2 1799465 N/A 1799470 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1799472 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction false false false 1f atg14-nrbf2-1 1799466 N/A 1799480 unspecified role unspecified role prey prey cell lysate cell lysate N/A 1799472 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false S1 atg14-becn1-11 1799467 N/A 1799481 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1799472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection asred fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1799470 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false S2b nrbf2-atg14-3 1799468 N/A 1799476 unspecified role unspecified role prey prey N/A 1799481 unspecified role unspecified role prey prey N/A 1799478 unspecified role unspecified role prey prey N/A 1799482 unspecified role unspecified role prey prey N/A 1799480 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 1g atg14-pik3c3-2 1799469 N/A 1799474 unspecified role unspecified role prey prey N/A 1799475 unspecified role unspecified role prey prey N/A 1799472 unspecified role unspecified role bait bait association association false false false 6D Association of VPS34 and VPS15 is decreased in Nrbf2 KO mice