UniProt UniProt http://www.uniprot.org jia-2013-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jia X., Weber E., Tokarev A., Lewinski M., Rizk M., Suarez M., Guatelli J., Xiong Y. In some instances a heterotetrameric AP1 complex expressed in and purified from E.coli has been used, confirmed by SDS-gel. idem for a truncated AP2 hemicomplex (alpha-1, sigma subunits) Origin of mu1 according Jia X. et al (2012); PubMed 22705789. Origin of expressed and /or purified proteins/constructs confirmed by the authors. HIV-1 Vpu sequence coordinates are differing from publication (confirmed). xiaofei.jia@yale.edu,jguatelli@ucsd.edu,yong.xiong@yale.edu xiaofei.jia@yale.edu eLife 2013 IMEx imex curation Only protein-protein interactions jia-2013-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Jia X., Weber E., Tokarev A., Lewinski M., Rizk M., Suarez M., Guatelli J., Xiong Y. Origin of mu1 according Jia X. et al (2012); PubMed 22705789. Origin of expressed and /or purified proteins/constructs confirmed by the authors. HIV-1 Vpu sequence coordinates are differing from publication (confirmed). xiaofei.jia@yale.edu,jguatelli@ucsd.edu,yong.xiong@yale.edu xiaofei.jia@yale.edu eLife 2013 IMEx imex curation Only protein-protein interactions jia-2013-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Jia X., Weber E., Tokarev A., Lewinski M., Rizk M., Suarez M., Guatelli J., Xiong Y. An heterotetrameric AP1 complex expressed in and purified from E.coli has been used (with the gamma subunit GST-tagged) Origin of mu1 according Jia X. et al (2012); PubMed 22705789. Origin of expressed and /or purified proteins/constructs confirmed by the authors. HIV-1 Vpu sequence coordinates are differing from publication (confirmed). xiaofei.jia@yale.edu,jguatelli@ucsd.edu,yong.xiong@yale.edu xiaofei.jia@yale.edu eLife 2013 IMEx imex curation Only protein-protein interactions jia-2013-4 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Jia X., Weber E., Tokarev A., Lewinski M., Rizk M., Suarez M., Guatelli J., Xiong Y. Origin of mu1 according Jia X. et al (2012); PubMed 22705789. Origin of expressed and /or purified proteins/constructs confirmed by the authors. HIV-1 Vpu sequence coordinates are differing from publication (confirmed). xiaofei.jia@yale.edu,jguatelli@ucsd.edu,yong.xiong@yale.edu xiaofei.jia@yale.edu eLife 2013 IMEx imex curation Only protein-protein interactions jia-2013-6 human-ht1080 Homo sapiens HT1080 fribrosarcoma cell line ht1080 confirmed as human with IEF of AST, LDH, NP established from the biopsy from a fibrosarcoma of a 35-year-old Caucasian man in 1972 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Jia X., Weber E., Tokarev A., Lewinski M., Rizk M., Suarez M., Guatelli J., Xiong Y. Origin of mu1 according Jia X. et al (2012); PubMed 22705789. Origin of expressed and /or purified proteins/constructs confirmed by the authors. HIV-1 Vpu sequence coordinates are differing from publication (confirmed). xiaofei.jia@yale.edu,jguatelli@ucsd.edu,yong.xiong@yale.edu xiaofei.jia@yale.edu eLife 2013 IMEx imex curation Only protein-protein interactions jia-2013-5 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Jia X., Weber E., Tokarev A., Lewinski M., Rizk M., Suarez M., Guatelli J., Xiong Y. AP1 core complex purfied from E. coli and a human_BST2-HIV1_Vpu fusion purified from E. coli have been used. Origin of mu1 according Jia X. et al (2012); PubMed 22705789. Origin of expressed and /or purified proteins/constructs confirmed by the authors. HIV-1 Vpu sequence coordinates are differing from publication (confirmed). xiaofei.jia@yale.edu,jguatelli@ucsd.edu,yong.xiong@yale.edu xiaofei.jia@yale.edu eLife 2013 IMEx imex curation Only protein-protein interactions jia-2013-7 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Jia X., Weber E., Tokarev A., Lewinski M., Rizk M., Suarez M., Guatelli J., Xiong Y. Origin of mu1 according Jia X. et al (2012); PubMed 22705789. Origin of expressed and /or purified proteins/constructs confirmed by the authors. HIV-1 Vpu sequence coordinates are differing from publication (confirmed). xiaofei.jia@yale.edu,jguatelli@ucsd.edu,yong.xiong@yale.edu xiaofei.jia@yale.edu eLife 2013 IMEx imex curation Only protein-protein interactions ap1m1_mouse AP-1 complex subunit mu-1 Ap1m1 Cltnm Golgi adaptor HA1/AP1 adaptin mu-1 subunit Mu-adaptin 1 AP-mu chain family member mu1A Mu1A-adaptin Clathrin coat assembly protein AP47 Clathrin coat-associated protein AP47 Adaptor protein complex AP-1 subunit mu-1 Clathrin assembly protein complex 1 mu-1 medium chain 1 Adaptor-related protein complex 1 subunit mu-1 protein protein mouse Mus musculus Mouse MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIEAVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMVKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSVKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ bst2_human Bone marrow stromal antigen 2 BST2 Tetherin HM1.24 antigen protein protein human Homo sapiens Human MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ vpu_hv1s1 Protein Vpu vpu U ORF protein Viral protein U protein protein hv1s1 Human immunodeficiency virus type 1 group M subtype B (isolate SF162) MQPLQILAIVALVVAAIIAIVVWTIVYIEYRKILRQRKIDRLIDRITERAEDSGNESEGDQEELSALVERGHLAPWDVDDL mint homomint ap1b1_human AP-1 complex subunit beta-1 Adaptor protein complex AP-1 subunit beta-1 Beta-adaptin 1 Beta-1-adaptin Golgi adaptor HA1/AP1 adaptin beta subunit Clathrin assembly protein complex 1 beta large chain AP1B1 ADTB1 BAM22 CLAPB2 Adaptor-related protein complex 1 subunit beta-1 protein protein human Homo sapiens Human MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYGTLLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICYIGTLASVYHKPPSAFVEGGRGVVHKSLPPRTASSESAESPETAPTGAPPGEQPDVIPAQGDLLGDLLNLDLGPPVSGPPLATSSVQMGAVDLLGGGLDSLMGDEPEGIGGTNFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPATPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSCTDLELSLKCRAPEVSQHVYQAYETILKN ap1s1_human AP-1 complex subunit sigma-1A Sigma-adaptin 1A Sigma1A-adaptin Golgi adaptor HA1/AP1 adaptin sigma-1A subunit HA1 19 kDa subunit Clathrin assembly protein complex 1 sigma-1A small chain Clathrin coat assembly protein AP19 Sigma 1a subunit of AP-1 clathrin Adaptor protein complex AP-1 subunit sigma-1A AP1S1 AP19 CLAPS1 Adaptor-related protein complex 1 subunit sigma-1A protein protein human Homo sapiens Human MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA ap1g1_mouse AP-1 complex subunit gamma-1 Ap1g1 Adtg Clapg1 Adaptor protein complex AP-1 subunit gamma-1 Golgi adaptor HA1/AP1 adaptin subunit gamma-1 Gamma1-adaptin Gamma-adaptin Clathrin assembly protein complex 1 gamma-1 large chain Adaptor-related protein complex 1 subunit gamma-1 protein protein mouse Mus musculus Mouse MPAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSSFREEDNTYRCRNVAKLLYMHMLGYPAHFGQLECLKLIASQKFTDKRIGYLGAMLLLDERQDVHLLMTNCIKNDLNHSTQFVQGLALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKAALCAVHVIRKVPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVPQLVRILKNLIMSGYSPEHDVSGISDPFLQVRILRLLRILGRNDDDSSEAMNDILAQVATNTETSKNVGNAILYETVLTIMDIKSESGLRVLAINILGRFLLNNDKNIRYVALTSLLKTVQTDHNAVQRHRSTIVDCLKDLDVSIKRRAMELSFALVNGNNIRGMMKELLYFLDSCEPEFKADCASGIFLAAEKYAPSKRWHIDTIMRVLTTAGSYVRDDAVPNLIQLITNSVEMHAYTVQRLYKAILGDYSQQPLVQVAAWCIGEYGDLLVSGQCEEEEPIQVTEDEVLDILESVLISNMSTSVTRGYALTAIMKLSTRFTCTVNRIKKVVSIYGSSIDVELQQRAVEYNALFKKYDHMRSALLERMPVMEKVTTNGPSEIVQTNGETEPAPLETKPPPSGPQPTSQANDLLDLLGGNDITPVIPTAPTSKPASAGGELLDLLGDITLTGAPAAAPTPASVPQISQPPFLLDGLSSQPLFNDIAPGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ ap2s1_human AP-2 complex subunit sigma Adaptor protein complex AP-2 subunit sigma AP2S1 Sigma2-adaptin Plasma membrane adaptor AP-2 17 kDa protein HA2 17 kDa subunit Clathrin coat assembly protein AP17 Clathrin coat-associated protein AP17 AP17 CLAPS2 Clathrin assembly protein 2 sigma small chain Adaptor-related protein complex 2 subunit sigma protein protein human Homo sapiens Human MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE d3zuy8_rat AP-2 complex subunit alpha Ap2a1 Ap2a1_predicted rCG_54084 protein protein rat Rattus norvegicus (Rat) Rat MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDLASRNPTFMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASPDLVPMGEWTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCVSLAVSRLSRIVSSASTDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDAAVKGRLVECLETVLNKAQEPPKSKKVQHSNAKNAILFETISLIIHYDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSEFSHEAVKTHIDTVINALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETADYAIREEIVLKVAILAEKYAVDYSWYVDTILNLIRIAGDYVSEEVWYRVLQIVTNRDDVQGYAAKTVFEALQAPACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKFHLCSVATRALLLSTYIKFINLFPETKATIQGVLRAGSQLRNADVELQQRAVEYLTLSSVASTDVLATVLEEMPPFPERESSILAKLKRKKGPGAASALDDSRRDTSSNDINGGVEPTPSNVSTPSPSADLLGLRAAPPPAAPPAPVGGNLLVDVFSDGPTAQPSLGPTPEEAFLSELEPPAPESPMTLLADPAPAADPGPEDIGPPIPEADELLNKFVCKNSGVLFENQLLQIGVKSEFRQNLGRMYLFYGNKTSVQFQSFLPTVVHPGDLQTHLAVQTKRVAAQVDGGAQVQQVLNIECLRDFLTPPLLSVRFRYGGTAQSLTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPLQEAQKIFKANHPMDAEVTKAKLLGFGSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNAQAQMYRLTLRTSKEPVSRHLCELLAQQF 5704048BEC825FDF ap2m1_mouse AP-2 complex subunit mu Adaptor protein complex AP-2 subunit mu AP-2 mu chain Ap2m1 Clapm1 Mu2-adaptin Plasma membrane adaptor AP-2 50 kDa protein Clathrin coat assembly protein AP50 Clathrin coat-associated protein AP50 Clathrin assembly protein complex 2 mu medium chain Adaptor-related protein complex 2 subunit mu protein protein mouse Mus musculus Mouse MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC tgon3_rat Trans-Golgi network integral membrane protein TGN38 Ttgn1 protein protein rat Rattus norvegicus (Rat) Rat MQFLVALLLLSVAVARALPSASKPNNTSSENNPPIQPSTPLPPGVDISQQVKTNRPTDQRLESDKEGQDKTVARTSASVSSGVESATNLNLDDSKKHPETADAKLKETLQQLLPVDPKQEKSGQKFTKDSGSPTGGDSDNTTGGDSNKTTGVDSDKTSGGDSNKPTGSDNDKPTGGDSNKPTSKVPSNTETPKIDKVQLTEKGQKPTLISKTESGEKLAGDSDFSLKPEKGDKSSEPTEDVETKEIEEGDTEPEEGSPLEEENEKVLGPSSSENQEGTLTDSMKDEKDDHYKDNSGNTSAESSHFFAYLVTAAVLVAVLYIAYHNKRKIIAFALEGKRSKVTRRPKASDYQRLNLKL ap3m1_rat AP-3 complex subunit mu-1 Clathrin assembly protein assembly protein complex 3 mu-1 medium chain Ap3m1 Mu-adaptin 3A Mu3A-adaptin Golgi adaptor AP-1 47 kDa protein homolog 1 HA1 47 kDa subunit homolog 1 Clathrin coat assembly protein AP47 homolog 1 Clathrin coat-associated protein AP47 homolog 1 P47A AP-3 adaptor complex mu3A subunit Adaptor-related protein complex 3 subunit mu-1 protein protein rat Rattus norvegicus (Rat) Rat MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPTVISTPHHYLISIYRDKLFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTILRSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHNISFKENSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLAWDVGKITPQKLPSLKGLVNLQSGAPKPEENPNLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYITKAGKFQVRT mint bst2_vpu_fusion humBST2(CD)_hiv1Vpu(CD) fusion protein protein protein synthetic construct synthetic construct MASTSYDYCRVPMEDGDKRCKGSDEASEGSGEYRKILRQRKIDRLIDRITERAEDSGNESEGDQEELSALVERGHLAPWDVDDL ap1m1_human AP-1 complex subunit mu-1 Golgi adaptor HA1/AP1 adaptin mu-1 subunit Mu-adaptin 1 AP-mu chain family member mu1A Mu1A-adaptin Clathrin coat assembly protein AP47 Clathrin coat-associated protein AP47 Adaptor protein complex AP-1 subunit mu-1 Clathrin assembly protein complex 1 mu-1 medium chain 1 AP1M1 CLTNM Adaptor-related protein complex 1 subunit mu-1 protein protein human Homo sapiens Human MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ bst2_vpu_fusion_chimera Human BST2-HIV-1 VPU fusion chimera protein protein synthetic construct synthetic construct MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVGGGSGGGSGGGSDYKDDDDKMQPLQILAIVALVVAAIIAIVVWTIVYIEYRKILRQRKIDRLIDRITERAEDSGNESEGDQEELSALVERGHLAPWDVDDL fbw1a_human F-box/WD repeat-containing protein 1A BTRC BTRCP FBW1A FBXW1A F-box and WD repeats protein beta-TrCP E3RSIkappaB pIkappaBalpha-E3 receptor subunit Epididymis tissue protein Li 2a protein protein human Homo sapiens Human MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLASTAMKTENCVAKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR ap1g1_human AP-1 complex subunit gamma-1 Adaptor protein complex AP-1 subunit gamma-1 Golgi adaptor HA1/AP1 adaptin subunit gamma-1 Gamma1-adaptin Clathrin assembly protein complex 1 gamma-1 large chain AP1G1 ADTG CLAPG1 Adaptor-related protein complex 1 subunit gamma-1 protein protein human Homo sapiens Human MPAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSSFREEDNTYRCRNVAKLLYMHMLGYPAHFGQLECLKLIASQKFTDKRIGYLGAMLLLDERQDVHLLMTNCIKNDLNHSTQFVQGLALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKAALCAVHVIRKVPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVPQLVRILKNLIMSGYSPEHDVSGISDPFLQVRILRLLRILGRNDDDSSEAMNDILAQVATNTETSKNVGNAILYETVLTIMDIKSESGLRVLAINILGRFLLNNDKNIRYVALTSLLKTVQTDHNAVQRHRSTIVDCLKDLDVSIKRRAMELSFALVNGNNIRGMMKELLYFLDSCEPEFKADCASGIFLAAEKYAPSKRWHIDTIMRVLTTAGSYVRDDAVPNLIQLITNSVEMHAYTVQRLYKAILGDYSQQPLVQVAAWCIGEYGDLLVSGQCEEEEPIQVTEDEVLDILESVLISNMSTSVTRGYALTAIMKLSTRFTCTVNRIKKVVSIYGSSIDVELQQRAVEYNALFKKYDHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTSQANDLLDLLGGNDITPVIPTAPTSKPSSAGGELLDLLGDINLTGAPAAAPAPASVPQISQPPFLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ ap1m1-bst2-1 1855565 N/A 1855572 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1855573 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1A ap1m1-vpu-1 1855565 N/A 1855574 unspecified role unspecified role unspecified role unspecified role n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false possible phosphoser-53 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false possible phosphoser-57 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1855572 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2C ap1b1-ap1g1-3 1855565 N/A 1855574 unspecified role unspecified role unspecified role unspecified role possible phosphoser-53 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false possible phosphoser-57 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P19554:p.[Glu63Ala;Leu67_Val68delinsAlaAla] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1855572 unspecified role unspecified role ancillary ancillary region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1855575 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1855576 unspecified role unspecified role ancillary ancillary ecoli Escherichia coli (strain K12) N/A 1855577 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 2A and B ap2a1-ap2s1-1 1855565 N/A 1855574 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false possible phosphoser-53 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false possible phosphoser-57 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1855578 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 1855579 unspecified role unspecified role neutral component neutral component D3ZUY8:p.[Ile370Ala;Ile374Ser;Leu393Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 2D ap2a1-ap2s1-2 1855565 N/A 1855574 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false possible phosphoser-53 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false possible phosphoser-57 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1855580 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 2E bst2-ap1m1-1 1855566 N/A 1855573 unspecified role unspecified role bait bait Q10589:p.Tyr8Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q10589:p.[Tyr6Ala;Tyr8Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q10589:p.Tyr6Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q10589:p.Val11Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false N/A 1855572 unspecified role unspecified role prey prey P35585:p.Asp174Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1D, 5E ttgn1-ap1m1-1 1855566 N/A 1855572 unspecified role unspecified role prey prey P35585:p.Asp174Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false N/A 1855581 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1D ttgn1-ap2m1-1 1855566 N/A 1855580 unspecified role unspecified role prey prey N/A 1855581 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1D ttgn1-1 1855566 N/A 1855582 unspecified role unspecified role prey prey N/A 1855581 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1D ap1g1-ap1b1-1 1855567 N/A 1855572 unspecified role unspecified role ancillary ancillary region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P35585:p.Asp319Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1855575 unspecified role unspecified role ancillary ancillary region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1855576 unspecified role unspecified role ancillary ancillary ecoli Escherichia coli (strain K12) N/A 1855577 unspecified role unspecified role bait bait c-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P22892:p.Arg15Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P22892:p.Gln28Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1855583 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false bst2_vpu_fusion:p.Arg44_Leu45delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false bst2_vpu_fusion:p.[Tyr6Ala;Tyr8Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Phosphorylation or respective (ser52asn, ser56asn) mutation of the HIV-1 Vpu fusion part does not change the association Fusion consists of human BST2 (1-21)-10aa linker-HIV1S1 Vpu(29-81) 1855682 1855672 1855686 1855681 physical association physical association false false false 3B, 4A and 6D, 7B ap1g1-bst2_vpu_fusion-1 1855567 N/A 1855572 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1855583 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false bst2_vpu_fusion:p.Arg44_Leu45delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Phosphorylation or respective (ser52asn, ser56asn) mutation of the HIV-1 Vpu fusion part does not change the association Fusion consists of human BST2 (1-21)-10aa linker-HIV1S1 Vpu(29-81) physical association physical association false false false 7C bst2_vpu_fusion_chimera-1 1855568 N/A 1855584 unspecified role unspecified role prey prey N/A 1855585 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged certain certain sequence position certain certain certain sequence position certain false bst2_vpu_fusion_chimera:p.[Tyr6Ala;Tyr8Ala;Glu149Ala;Leu153_Val154delinsAlaAla] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Fusion chimera consists of human BST2(1-66)-GGGsx3 linker-Flag epitope-HIV-1 full length Individual mutations in the BST2 or Vpu respective fusion chimera parts have no effect; combination of both is nescessary tp prevent association with AP1 mu. physical association physical association false false false 4C btrc-vpu-1 1855568 N/A 1855574 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection P19554:p.[Ser53Asn;Ser57Asn] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Vpu mutant arg_leu45-46ala_ala does interact Vpu has been codon optimized for expression N/A 1855586 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 7G ap1g1-bst2-1 1855569 N/A 1855574 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection P19554:p.[Glu63Ala;Leu67_Val68delinsAlaAla] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 1855587 unspecified role unspecified role neutral component neutral component N/A 1855573 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection Q10589:p.[Tyr6Ala;Tyr8Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 9A ap1g1-bst2-2 1855569 N/A 1855587 unspecified role unspecified role neutral component neutral component N/A 1855585 unspecified role unspecified role neutral component neutral component bst2_vpu_fusion_chimera:p.[Tyr6Ala;Tyr8Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false bst2_vpu_fusion_chimera:p.[Glu149Ala;Leu153_Val154delinsAlaAla] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 9C ap1b1-ap1g1-7 1855570 N/A 1855572 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1855575 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1855576 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 1855577 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1855583 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association false false false 5, Table 1 3.0A Rworking 18.6 %, Rfree 22.9 % ap1g1-bst2-3 1855571 N/A 1855574 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection N/A 1855587 unspecified role unspecified role neutral component neutral component N/A 1855573 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 9—figure supplement 1 Colocalization not changed by Vpu mutant (ser53asp,ser57asn)