IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ cragle-2014-1 xenla-oocyte Xenopus laevis oocyte Oocyte pull down pull down anti tag western anti tag western blot anti tag western Cragle C., MacNicol AM. Immature Stage VI oocytes. Pulldown was carried out in the presence of RNase1. (to show that the interactions do not occur by simple co-occupancy of GLD2 and Musashi proteins on the same mRNA.) Musashi-1 was identified as UniProt Q91808 (Nrp1b NCBI Accession M34895) from Reference 25 and Xenbase. HA-XGld2 tag location found from pmid:15070731. The identity of GST-CPEB1/GST-CPEB was found from pmid:7954828. Musashi-2 was identified as Q91920 from Xenbase. Angus@UAMS.edu From Macnicol, Angus <Angus@uams.edu> The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation cragle-2014-2 xenla-oocyte Xenopus laevis oocyte Oocyte pull down pull down western blot western blot Immuno blot Immuno blot Cragle C., MacNicol AM. Immature Stage VI oocytes. Pulldown was carried out in the presence of RNase1. Musashi-1 (Msi-1 or Nrp1b) was identified from Ref. 25 NCBI Accession M34895 as UniProt Q91808. HA-XGld2 tag location found from pmid:15070731. The identity of GST-CPEB1/GST-CPEB was found from pmid:7954828. Angus@UAMS.edu From Macnicol, Angus <Angus@uams.edu> The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation q91808_xenla msi1.L LOC397764 msi1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog METEAPQPGLSPPDSAHDPCKMFIGGLSWQTTQEGLREYFSHFGDVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPKEVMSPTGSVRGRSRVMPYGMDAFMLGIGMLGYPGFQAATYASRSYTGIAPGYTYQFPEFRVERTPLPGAPVLPELTAIPLTAYGPVAAAAAAVVRGGFLGTSSPGPMAELYGAANQESAVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH gld2a_xenla Poly(A) RNA polymerase GLD2-A tent2-a PAP-associated domain-containing protein 4-A gld2-a papd4-a protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MYPNSPSLGRIPLPLPCEQQQQASGYSDKLPVSAAPELLSPEQFIQASLNIQKHANLSRMLMNGNVLTVPPVSSPPWAYLNHSPLISPGSPSSSFQNRKRRSDEGNVSYDVKRQRFHSPQEQTVNHQAVPLRGDLRCSYPGSPAFPLLQSPSPPVLKEHVSNSGDCWLYDHIDTTLPVAEDKLSQQILDLFQALQQQVCDIKKKDICRAELQREIQQIFPQSRLYLVGSSLNGFGTRISDADLCLVLKEEPMNQHTEATQILGLLHKLFYTRLSYIERLQFIRAKVPIVKFRDKVSGAEFDLNVNNVVGIRNTFLLRTYAYLESRVRPLVLVIKKWANHHGINDASRGTLSSYTLVLMVLHYLQTLPEPILPSLQKKYPECFDLSMQLNLVHHAPRNIPPYLSKNETPLGDLLLGFLKYFAVEFDWSKDIISVREGKALPRSDDYLWRNKYICVEEPFDGTNTARAVYERQKFDMIRAEFLKAWGALRDDRDLYSLLPVTAIVKKMNSL cpe1a_xenla Cytoplasmic polyadenylation element-binding protein 1-A 58 kDa CPE-binding protein cpeb1-a cpeb protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAFPLKDDLGRAKDCWGCPSDTPALSTCSNADIFRRINAMLDNSLDFTGVCTTPNTKGKCEHLQDYQDTEGPAASRMLFSTSHEPLPRGLPDTNDLCLGLQSLSLTGWDRPWSTQDSEAGGHSSTPTAAQSVFSMLNSPMGKPSPLGFLTFDPIGSDLMEKYPTPLLRSSRLDSRSILDSRSSSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLPLGGGVSRDPLKLGIGSRLDQDHAALAAATVSPLGITKGWPSTSVWPSWDLLDSAEDPFSIEREARLHRQAAAVNEATCTWSGQLPPRNYKNPVYSCKVFLGGVPWDITETGLINTFRVFGALSVEWPGKDGKHPRCPPKGNMPKGYVYLVFESEKSVRALLQACSQDLLSQDGLSEHYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSKTVFVGALHGMLNAEALASIMNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTAKFTKKVQIDPYLEDSVCQVCNAQPGPFFCRDQVCFKYFCRSCWHWQHSMEILRHHRPLMRNQKSRDSS EF812949F5B4DE54 parn_xenla Poly(A)-specific ribonuclease PARN parn Deadenylating nuclease Deadenylation nuclease Polyadenylate-specific ribonuclease parn-A protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MEITRSNFKDTLPKVYKAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYTKLKKHSMEFLLFQFGLCTFNYDNTEAKYLMKSFNFYIFPKPFNRNSPDKKFVCQSSSIDFLANQGFDFNKVFRNGIPYLNQEEERVLRDQYEDRRSQSNGASTMSYISPNSSKTPVSIPDEQKGFIDKVVERVEDFLKNEQKSMNVEPCTGYQRKLIYQTLNWKYPRGIHVETVESEKKERYIVISKVDEEERKRMEQQKQAKEREELDDAVGFSRIIQAISSSGKLVVGHNMLLDVMHTIHQFFCQLPDELNEFKEVTNCVFPRVLDTKLMASTNPFKEIIYNTSLAELEKRLKEAPFKPPKVDSAEGFQSYNTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKDYVSCRSKIVRPFFNKLFLMRIMDIPYLNLEGPDLQPKRDNVLHVTFPKEWKTSDLYQLFSAFGNIQVSWIDDTSAFVSLSQPEQVQIAVNTSKYAESYRIQTYAEYIEKKNDESQTKRKWAEDGWKDLERKRLKTQYNSYIPQNPVFYGNCFAPSFAVKRSMSPIQEEAASDDTEEVHTHENDPSNPGATEQGKKPKNHKRQKIDSAPPETSDGGSSVLFEVPDTW q91920_xenla msi2.S msi2 xrp1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MEADGSQATSGSPNDSQHDPGKMFIGGLSWQTSPDSLRDYFNKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLAQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQYGKVEDAMLMFDKTTNRHRGFGFVTFEIEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYSYQFPGFPAATTYGPVTAAAVAAARGSGIPDYGFYTTPGDQRATLSFADYGSMGPRTAQMLRSEHAASASNSPLHHLPSPDQFKSPVLNSYSAQPNYGTPASPTGTNPGRPGGFPGANSPGPVADLYGTASQDSGVGNYISAASPQPGSGFSHGMAGPLIATAFTNGYH msi1h_mouse RNA-binding protein Musashi homolog 1 Msi1 Msi1h protein protein mouse Mus musculus Mouse METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERSPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH mint RNA binding protein that regulates the expression of target mRNAs at the translation level. Regulates expression of the NOTCH1 antagonist NUMB. Binds RNA containing the sequence 5'-GUUAGUUAGUUAGUU-3' and other sequences containing the pattern 5'-[GA]U(1-3)AGU-3'. May play a role in the proliferation and maintenance of stem cells in the central nervous system msi2h_mouse RNA-binding protein Musashi homolog 2 Msi2 Msi2h protein protein mouse Mus musculus Mouse MEANGSPGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSVLNSYSAQPNFGAPASPAGSNPARPGGFPGANSPGPVADLYGPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNGYH mint RNA binding protein that regulates the expression of target mRNAs at the translation level. May play a role in the proliferation and maintenance of stem cells in the central nervous system gld2_mouse Poly(A) RNA polymerase GLD2 Tent2 Gld2 PAP-associated domain-containing protein 4 Papd4 Terminal nucleotidyltransferase 2 protein protein mouse Mus musculus Mouse MFPNSILGRPPFTPTHQQHNNFFALSPTLYSHQQLIDAQFNFQNVDLSRAVSLQPLTYGTVSPIQTSTSPLFRGRKRISDEKAFPLDGKRQRFHSPHQEPTIINQLVPLSGDRRYSMPPLFHTHYIPDIVRCVPPLREIPLLEPREITLPEAKDKLSQQILELFETCQQQASDLKKKELCRAQLQREIQLLFPQSRLFLVGSSLNGFGARSSDGDLCLVVKEEPCFFQVNQKTEARHILTLVHKHFCTRLSGYIERPQLIRAKVPIVKFRDKVSCVEFDLNVNNTVGIRNTFLLRTYAYLENRVRPLVLVIKKWASHHDINDASRGTLSSYSLVLMVLHYLQTLPEPILPSLQKIYPESFSTSVQLHLVHHAPCNVPPYLSKNESSLGDLLLGFLKYYATEFDWNTQMISVREAKAIPRPDDMEWRNKYICVEEPFDGTNTARAVHEKQKFDMIKDQFLKSWQRLKNKRDLNSVLPLRAATLKR loc397764-papd4_a-1 1887514 N/A 1887516 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 1887517 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro physical association physical association false false false 1 A/C, 2 GLD2interacts with Musashi-1 in both immature and progesterone-stimulated oocytes. cpeb1_a-papd4_a-1 1887514 N/A 1887518 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 1887517 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro physical association physical association false false false 1A, 2 Positive control loc397764-papd4_a-3 1887514 N/A 1887516 unspecified role unspecified role prey prey c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 1887519 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro physical association physical association false false false 1 D parn-loc397764-1 1887514 N/A 1887518 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 1887519 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro physical association physical association false false false 1 E Progesterone -CHEBI:17026 Dissociation of PARN from CPEB1 was observed after progesterone stimulation. loc397764-papd4_a-4 1887514 N/A 1887520 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 1887517 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro physical association physical association false false false 2 msi2-papd4_a-1 1887514 N/A 1887521 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 1887517 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro physical association physical association false false false 2i msi1-papd4_a-1 1887514 N/A 1887522 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 1887517 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro physical association physical association false false false 2ii loc397764-papd4_a-5 1887514 N/A 1887516 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 1887523 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 6 loc397764-papd4-1 1887514 N/A 1887521 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 1887523 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 6i loc397764-papd4_a-2 1887515 N/A 1887516 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 1887517 unspecified role unspecified role prey prey physical association physical association false false false 1B