IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wolff-2014-1 yeast Saccharomyces cerevisiae Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wolff NA., Ghio AJ., Garrick LM., Garrick MD., Zhao L., Fenton RA., Thévenod F. frank.thevenod@uni-wh.de,natascha.wolff@uni-wh.de F.T.,frank.thevenod@ uni-wh.de Human kidney NubG-x cDNA FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation Only protein-protein interactions wolff-2014-2 human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wolff NA., Ghio AJ., Garrick LM., Garrick MD., Zhao L., Fenton RA., Thévenod F. frank.thevenod@uni-wh.de,natascha.wolff@uni-wh.de F.T.,frank.thevenod@ uni-wh.de FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation Only protein-protein interactions wolff-2014-3 human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wolff NA., Ghio AJ., Garrick LM., Garrick MD., Zhao L., Fenton RA., Thévenod F. frank.thevenod@uni-wh.de,natascha.wolff@uni-wh.de F.T.,frank.thevenod@ uni-wh.de FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation Only protein-protein interactions cox2_human Cytochrome c oxidase subunit 2 MT-CO2 COII COXII MTCO2 Cytochrome c oxidase polypeptide II COX2 protein protein human Homo sapiens Human MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL p49281-3 Natural resistance-associated macrophage protein 2 Divalent cation transporter 1 Divalent metal transporter 1 Solute carrier family 11 member 2 OK/SW-cl.20 1A-IRE SLC11A2 DCT1 DMT1 NRAMP2 protein protein human Homo sapiens Human MRKKQLKTEAAPHCELKSYSKNSATQVSTMVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKLLWILLLATLVGLLLQRLAARLGVVTGLHLAEVCHRQYPKVPRVILWLMVELAIIGSDMQEVIGSAIAINLLSVGRIPLWGGVLITIADTFVFLFLDKYGLRKLEAFFGFLITIMALTFGYEYVTVKPSQSQVLKGMFVPSCSGCRTPQIEQAVGIVGAVIMPHNMYLHSALVKSRQVNRNNKQEVREANKYFFIESCIALFVSFIINVFVVSVFAEAFFGKTNEQVVEVCTNTSSPHAGLFPKDNSTLAVDIYKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVMEGFLNLKWSRFARVVLTRSIAIIPTLLVAVFQDVEHLTGMNDFLNVLQSLQLPFALIPILTFTSLRPVMSDFANGLGWRIAGGILVLIICSINMYFVVVYVRDLGHVALYVVAAVVSVAYLGFVFYLGWQCLIALGMSFLDCGHTVSISKGLLTEEATRGYVK tom6_human Mitochondrial import receptor subunit TOM6 homolog TOMM6 Overexpressed breast tumor protein Translocase of outer membrane 6 kDa subunit homolog OBTP TOM6 protein protein human Homo sapiens Human MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV nram2_human Natural resistance-associated macrophage protein 2 SLC11A2 DCT1 DMT1 NRAMP2 Divalent cation transporter 1 Divalent metal transporter 1 Solute carrier family 11 member 2 OK/SW-cl.20 protein protein human Homo sapiens Human MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKLLWILLLATLVGLLLQRLAARLGVVTGLHLAEVCHRQYPKVPRVILWLMVELAIIGSDMQEVIGSAIAINLLSVGRIPLWGGVLITIADTFVFLFLDKYGLRKLEAFFGFLITIMALTFGYEYVTVKPSQSQVLKGMFVPSCSGCRTPQIEQAVGIVGAVIMPHNMYLHSALVKSRQVNRNNKQEVREANKYFFIESCIALFVSFIINVFVVSVFAEAFFGKTNEQVVEVCTNTSSPHAGLFPKDNSTLAVDIYKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVMEGFLNLKWSRFARVVLTRSIAIIPTLLVAVFQDVEHLTGMNDFLNVLQSLQLPFALIPILTFTSLRPVMSDFANGLGWRIAGGILVLIICSINMYFVVVYVRDLGHVALYVVAAVVSVAYLGFVFYLGWQCLIALGMSFLDCGHTCHLGLTAQPELYLLNTMDADSLVSR dmt1-coxll-1 1801203 N/A 1801206 unspecified role unspecified role prey prey NubG-xprey NubG-x-Cox2 nub nub n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1801207 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 dmt1-tom6-1 1801203 N/A 1801208 unspecified role unspecified role prey prey n-terminal nub nub n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1801207 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 dmt1-1-cox2-1 1801204 N/A 1801206 unspecified role unspecified role prey prey N/A 1801209 unspecified role unspecified role bait bait physical association physical association false false false Fig 2B slc11a2-mt_co2-2 1801205 N/A 1801206 unspecified role unspecified role prey prey N/A 1801207 unspecified role unspecified role bait bait c-terminus DMT1-1A/+IRE-flag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig 2D