UniProt UniProt http://www.uniprot.org mori-2013-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mori Y., Matsui T., Omote D., Fukuda M. nori@tohoku.ac.jp Biochemical and biophysical research communications 2013 IMEx mimix curation Mouse UACA has been mapped to Uaca isoform 3 according to the seq length given in the publication (fig1A). Origin of Rab39A and Rab39B constructs according ref 19 (pmid 16923123). Only protein-protein interactions imex curation mori-2013-3 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mori Y., Matsui T., Omote D., Fukuda M. nori@tohoku.ac.jp Biochemical and biophysical research communications 2013 IMEx mimix curation Mouse UACA has been mapped to Uaca isoform 3 according to the seq length given in the publication (fig1A). Origin of Rab39A and Rab39B constructs according ref 19 (pmid 16923123). Only protein-protein interactions imex curation mori-2013-4 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Mori Y., Matsui T., Omote D., Fukuda M. Mouse UACA has been mapped to Uaca isoform 3 according to the seq length given in the publication (fig1A). Origin of Rab39A and Rab39B constructs according ref 19 (pmid 16923123). nori@tohoku.ac.jp Biochemical and biophysical research communications 2013 imex curation mimix curation Only protein-protein interactions mori-2013-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mori Y., Matsui T., Omote D., Fukuda M. nori@tohoku.ac.jp mouse testis and embryo mixed cDNA libraries Biochemical and biophysical research communications 2013 IMEx mimix curation Mouse UACA has been mapped to Uaca isoform 3 according to the seq length given in the publication (fig1A). Origin of Rab39A and Rab39B constructs according ref 19 (pmid 16923123). Only protein-protein interactions imex curation rb39b_mouse Ras-related protein Rab-39B Rab39b protein protein mouse Mus musculus Mouse MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVIKSERRCLC q8cgb3-3 Uveal autoantigen with coiled-coil domains and ankyrin repeats Nuclear membrane-binding protein Uaca Kiaa1561 protein protein mouse Mus musculus Mouse MKSLKSRLWKQDAPGPTSPSSPTAVASTQSAEWNKYDDRLMKAAERGDVEKVSSILAKKGVHPGKLDVEGRSAFHVVASKGNLECLNAILTHGIDVATRDSAGRNALHLAAKYGHALCLQKLLQYNCPTEHVDLQGRTALHDAVMADCPSSIQLLCDHGASVNAKDIDGRTPLVLATQMCRPTICQLLIDRGADVNSRDKQNRTALMLGCEYGCRDAVEVLVKNGADLTLLDALGHDSSYYARIGDNLDILNLLKTASENTNKGGGRELWRKGPPLQQRNLSHTQDEGSVKSTQREQREPHSFQDLEIENEDLREKLRKIQQEQRILLDKVNGLQLQLNEEVMVADDLESEREKPKSLLAAKEKQHEESLRTIEALKNRFKYFESDHPGPGSYPSNRKEDMLHKQGQMYTTEPQCASPGIPPHMHSRSMLRPLELSLPSQTSYSENEILKKELETLRTYYDSAKQDRLKFQNELAHKVAECKALALECERVKEDSDEQIKQLEDALKDVQKRMYESEGKVKQMQTHFLALKEHLTNEAATGSHRIIEELREQLKDLKGKYEGASAEVGKLRSQIKQSEMLVGEFKRDEGRLVEENKRLQKECGTCEVELERRGRRVVELEGQLKELGAKLALSVPTEKFESMKSSLSNDINEKVKRLAEVGRDYESAQGEIRQLKRDLESVRAQHIRPEEHEQLRSRLEQKSGELGKKVSELTLKNQTLQKDVEKLHADNKLLNQQVHSLTVEMKTRYVPLRVSEEMKRSHDVNVEDLNKKLSEATQRYAEKKQEAERLLAENDKLTKNVSRLEAVFVAPEKHEKELMGLKSNIAELKKQLSELNKKCGEGQEKIRALMSENSSLKKTLSSQYVPAKTHEEVKASLNSTVEKTNRALLEAKKRFDDTSQEVSKLRDENEVLRRNLENVQNQMKADYVSLEEHSRRMSTVSQSLKEAQEANAAILADHRQGQEEIVSLHAEIKAQKKELDTIQECIKLKYAPLARLEECERKFKATEKGLKEQLSEQTHKCRQRDEEVKKGKQENERLRADLAALQKELQDRNALAEEAREAERALSGKADELSKQLKDLSQKYSDVKSEREKLVEEKAKQASEILAAQNLLQKQPVPLEQVEALKKSLNGTIEQLKEELRSKQRCLEREQQTVSQLQQLLENQKNSSVTLAEHLKLKEALEKEVGIMKASLREKEEESQKKTKEVSKLQTEVQTTKQALKNLETREVVDMSKYKATKNDLETQISNLNDKLASLNRKYDQACEEKVSAKDEKELLHLSIEQEIRDQKERCDKSLTTIMELQQRIQESAKQIEAKDNKITELLNDVERLKQALNGLSQLTYSSGSPTKRQSQLVDTLQQRVRDLQQQLADADRQHQEVIAIYRTHLLSAAQGHMDEDVQAALLQIIQMRQGLVC No experimental confirmation available. rb39a_mouse Ras-related protein Rab-39A Rab39a Rab39 protein protein mouse Mus musculus Mouse METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLHSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMHVQPFQIVFLLVGHKCDLASQRQVSREEAERLSTDCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC rab39b-uaca-2 1795775 N/A 1795779 unspecified role unspecified role bait bait Q8BHC1:p.Gln68Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q8BHC1:p.Ser22Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false N/A 1795780 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1b and C rab39a-uaca-1 1795775 N/A 1795781 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q8BHD0:p.Gln72Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false Q8BHD0:p.Ser22Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false N/A 1795780 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1B and C uaca-rab39a-1 1795776 N/A 1795781 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q8BHD0:p.Gln72Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false Q8BHD0:p.Ser22Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1795780 unspecified role unspecified role bait bait region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1D rab39b-uaca-4 1795776 N/A 1795779 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q8BHC1:p.Gln68Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q8BHC1:p.Ser22Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false N/A 1795780 unspecified role unspecified role bait bait region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1D uaca-rab39a-2 1795777 N/A 1795781 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q8BHD0:p.Gln72Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false rmstrawberry rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1795780 unspecified role unspecified role neutral component neutral component n_terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false 2, Supp 1C. rab39b-uaca-3 1795777 N/A 1795779 unspecified role unspecified role neutral component neutral component rmstrawberry rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q8BHC1:p.Gln68Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1795780 unspecified role unspecified role neutral component neutral component n_terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false 2D, Supp 1C. rab39b-uaca-1 1795778 N/A 1795780 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1795779 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q8BHC1:p.Gln68Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1A