UniProt UniProt http://www.uniprot.org starokadomskyy-2013-3 CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down western blot western blot Immuno blot Immuno blot Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation starokadomskyy-2013-2 CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation starokadomskyy-2013-1 CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. tap tandem affinity purification TAP TAP tap sequence tag sequence tag identification sequence tag Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation starokadomskyy-2013-9 CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation starokadomskyy-2013-10 CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation starokadomskyy-2013-4 CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation starokadomskyy-2013-6 CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. human-lcl Human-lymphoblastoid cell line,EBV transformed B lymphocytes lcl lcl-lymphoblastoid cell line,EBV transformed B lymphocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. EBV-immortalized B lymphocytes from individuals affected by XLID (X-linked intellectual disability) and in some instances carrying the CCDC22 T17A mutation. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation starokadomskyy-2013-8 CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation starokadomskyy-2013-5 CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation starokadomskyy-2013-7 CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation ccd22_human Coiled-coil domain-containing protein 22 CCDC22 CXorf37 JM1 protein protein human Homo sapiens Human MEEADRILIHSLRQAGTAVPPDVQTLRAFTTELVVEAVVRCLRVINPAVGSGLSPLLPLAMSARFRLAMSLAQACMDLGYPLELGYQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVASLLEHHALQLCQQTGRDRPGDEDWVHRTSRLPPQEDTRAQRQRLQKQLTEHLRQSWGLLGAPIQARDLGELLQAWGAGAKTGAPKGSRFTHSEKFTFHLEPQAQATQVSDVPATSRRPEQVTWAAQEQELESLREQLEGVNRSIEEVEADMKTLGVSFVQAESECRHSKLSTAEREQALRLKSRAVELLPDGTANLAKLQLVVENSAQRVIHLAGQWEKHRVPLLAEYRHLRKLQDCRELESSRRLAEIQELHQSVRAAAEEARRKEEVYKQLMSELETLPRDVSRLAYTQRILEIVGNIRKQKEEITKILSDTKELQKEINSLSGKLDRTFAVTDELVFKDAKKDDAVRKAYKYLAALHENCSQLIQTIEDTGTIMREVRDLEEQIETELGKKTLSNLEKIREDYRALRQENAGLLGRVREA comd1_human COMM domain-containing protein 1 COMMD1 C2orf5 MURR1 Protein Murr1 protein protein human Homo sapiens Human MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFNQLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHTPVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN comd2_human COMM domain-containing protein 2 COMMD2 HSPC042 My004 protein protein human Homo sapiens Human MLLELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQHGVEGLTYLLTESSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTILSELAPSLPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALEEMKTNHCRRVVRNIK comd3_human COMM domain-containing protein 3 Protein Bup Protein PIL COMMD3 BUP C10orf8 protein protein human Homo sapiens Human MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQL comd4_human COMM domain-containing protein 4 COMMD4 protein protein human Homo sapiens Human MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG comd5_human COMM domain-containing protein 5 COMMD5 HT002 Hypertension-related calcium-regulated gene protein protein protein human Homo sapiens Human MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQRLGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKRCERRLQD comd6_human COMM domain-containing protein 6 COMMD6 MSTP076 protein protein human Homo sapiens Human MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETV comd7_human COMM domain-containing protein 7 COMMD7 C20orf92 protein protein human Homo sapiens Human MGRLHCTEDPVPEAVGGDMQQLNQLGAQQFSALTEVLFHFLTEPKEVERFLAQLSEFATTNQISLGSLRSIVKSLLLVPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPTLARWAIGQTLMINQLIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKGNQTENVYIELTLPQFYSFLHEMERVRTSMECFC comd8_human COMM domain-containing protein 8 COMMD8 MDS022 protein protein human Homo sapiens Human MEPEEGTPLWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNLPDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLK comd9_human COMM domain-containing protein 9 COMMD9 HSPC166 protein protein human Homo sapiens Human MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK comda_human COMM domain-containing protein 10 COMMD10 HSPC305 PTD002 protein protein human Homo sapiens Human MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFYNKLETIQAQLDSLT cul2_human Cullin-2 CUL2 protein protein human Homo sapiens Human MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA cul1_human Cullin-1 CUL1 protein protein human Homo sapiens Human MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA cul3_human Cullin-3 CUL3 KIAA0617 protein protein human Homo sapiens Human MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMYKLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFRFMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA eloc_human Elongin-C ELOC Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 TCEB1 Transcription elongation factor B polypeptide 1 protein protein human Homo sapiens Human MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC cul5_human Cullin-5 CUL5 VACM1 Vasopressin-activated calcium-mobilizing receptor 1 protein protein human Homo sapiens Human MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA birc3_human_gene Human BIRC3 gene gene gene human Homo sapiens Human tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL skp1_human S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 p19skp1 RNA polymerase II elongation factor-like protein Organ of Corti protein 2 Organ of Corti protein II SIII Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK commd1-ccdc22-2 1776733 n/a 1776743 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776744 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection comm_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1D and 3C commd2-ccdc22 1776733 n/a 1776745 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776743 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association false false false 1D commd3-ccdc22 1776733 n/a 1776746 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776743 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association false false false 1D commd4-ccdc22 1776733 n/a 1776747 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776743 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association false false false 1D commd5-ccdc22 1776733 n/a 1776743 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776748 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1D commd6-ccdc22-1 1776733 n/a 1776743 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776749 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1D commd7-ccdc22 1776733 n/a 1776743 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776750 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1D commd8-ccdc22 1776733 n/a 1776751 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776743 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association false false false 1D commd9-ccdc22-2 1776733 n/a 1776752 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776743 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association false false false 1D commd10-ccdc22-2 1776733 n/a 1776743 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776753 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1D ccdc22-commd1-5 1776733 n/a 1776744 unspecified role unspecified role unspecified role unspecified role n/a 1776743 unspecified role unspecified role unspecified role unspecified role nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3B commd1-cul2-2 1776733 n/a 1776754 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776744 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6E CCDC22 has not been required for the association commd8-commd1-1 1776733 n/a 1776744 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776755 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776756 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776751 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6E CCDC22 has not been required for the association cul2-commd1-3 1776733 n/a 1776757 unspecified role unspecified role prey prey n/a 1776744 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection tb_biotin_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1776754 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false S7A commd1-ccdc22-6 1776733 n/a 1776754 unspecified role unspecified role prey prey n/a 1776744 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection tb_biotin_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1776743 unspecified role unspecified role prey prey n/a 1776757 unspecified role unspecified role prey prey association association false false false S7A GST-purified Cul2:COMMD1 complex (EBI-10107357) has been re-preciptitated against strep tag and blotted for endogenous CCDC22 and Elongin C. ccdc22-commd1-1 1776734 n/a 1776743 unspecified role unspecified role bait bait n/a 1776744 unspecified role unspecified role prey prey physical association physical association false false false 1B and S6B Association has been found with or without TNF treatment commd6-ccdc22 1776734 n/a 1776749 unspecified role unspecified role bait bait n/a 1776743 unspecified role unspecified role prey prey n/a 1776744 unspecified role unspecified role prey prey association association false false false 1C commd1-ccdc22-1 1776734 n/a 1776744 unspecified role unspecified role bait bait n/a 1776743 unspecified role unspecified role prey prey n/a 1776749 unspecified role unspecified role prey prey association association false false false 1C commd9-ccdc22-1 1776734 n/a 1776752 unspecified role unspecified role bait bait n/a 1776743 unspecified role unspecified role prey prey physical association physical association false false false 1C commd10-ccdc22-1 1776734 n/a 1776743 unspecified role unspecified role prey prey n/a 1776753 unspecified role unspecified role bait bait physical association physical association false false false 1C commd6-commd1-1 1776734 n/a 1776753 unspecified role unspecified role prey prey n/a 1776749 unspecified role unspecified role bait bait n/a 1776744 unspecified role unspecified role prey prey association association false false false 2B Association not dependent on presence of CCDC22 (siRNA for CCDC22 transfected) commd6-ccdc22-2 1776734 n/a 1776753 unspecified role unspecified role prey prey n/a 1776743 unspecified role unspecified role prey prey n/a 1776744 unspecified role unspecified role prey prey n/a 1776749 unspecified role unspecified role bait bait association association false false false 2B ccdc22-cul1 1776734 n/a 1776743 unspecified role unspecified role bait bait n/a 1776754 unspecified role unspecified role prey prey n/a 1776756 unspecified role unspecified role prey prey n/a 1776755 unspecified role unspecified role prey prey association association false false false 6C ccdc22-commd1-7 1776734 n/a 1776744 unspecified role unspecified role prey prey n/a 1776743 unspecified role unspecified role bait bait n/a 1776753 unspecified role unspecified role prey prey association association false false false 6D CUL1 or CUL2 have not been required for the association commd1-ccdc22 1776735 n/a 1776747 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776743 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776749 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776746 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776744 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection ha_biotin_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false 1A commd9-ccdc22 1776735 n/a 1776752 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection ha_biotin_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1776753 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776748 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776743 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776749 unspecified role unspecified role prey prey cell lysate cell lysate association association false false false 1A commd10-ccdc22 1776735 n/a 1776749 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776748 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776752 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776743 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1776753 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection ha_biotin_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false 1A cul1-ccdc22-1 1776736 n/a 1776755 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776743 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S9A cul3-ccdc22 1776736 n/a 1776743 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776756 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S9A cul5-ccdc22 1776736 n/a 1776758 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776743 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S9A ccdc22-birc3 1776737 n/a 1776743 unspecified role unspecified role bait bait n/a 1776759 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp fig 7C TNF ccdc22-birc3-1 1776737 n/a 1776759 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776744 unspecified role unspecified role bait bait association association false false false Supp fig 7C-i TNF commd1-birc3 1776737 n/a 1776759 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776760 unspecified role unspecified role bait bait association association false false false Supp fig 7C-ii TNF ccdc22-commd1-2 1776738 n/a 1776752 unspecified role unspecified role prey prey n/a 1776746 unspecified role unspecified role prey prey n/a 1776750 unspecified role unspecified role prey prey n/a 1776745 unspecified role unspecified role prey prey n/a 1776751 unspecified role unspecified role prey prey n/a 1776747 unspecified role unspecified role prey prey n/a 1776753 unspecified role unspecified role prey prey n/a 1776744 unspecified role unspecified role prey prey n/a 1776749 unspecified role unspecified role prey prey n/a 1776748 unspecified role unspecified role prey prey n/a 1776743 unspecified role unspecified role bait bait c-terminus lap tag lap tag lap tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false 1E ccdc22-commd1-3 1776738 n/a 1776751 unspecified role unspecified role prey prey n/a 1776749 unspecified role unspecified role prey prey n/a 1776750 unspecified role unspecified role prey prey n/a 1776748 unspecified role unspecified role prey prey n/a 1776746 unspecified role unspecified role prey prey n/a 1776745 unspecified role unspecified role prey prey n/a 1776752 unspecified role unspecified role prey prey n/a 1776743 unspecified role unspecified role bait bait n-terminus lap tag lap tag lap tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1776747 unspecified role unspecified role prey prey n/a 1776753 unspecified role unspecified role prey prey n/a 1776744 unspecified role unspecified role prey prey association association false false false S2 commd1-ccdc22-3 1776739 n/a 1776744 unspecified role unspecified role bait bait n/a 1776743 unspecified role unspecified role prey prey O60826:p.Thr17Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Variant found in a family affected by mental retardation; UniProt FTId: VAR_065912 A CCDC22 variant glu239lys also interacts physical association physical association false false false 3 D/F rela-nfkbia-16 1776739 n/a 1776760 unspecified role unspecified role bait bait n/a 1776761 unspecified role unspecified role prey prey possible_phosphores phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6a In lymphoblastoid cell lines from patients with a CCDC22 thr17ala mutation, phosphorylated NFKBIA/IKBa is much less ubiquitinated compared to tissue from wildtype CCDC22. cul1-ccdc22 1776740 n/a 1776755 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776743 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 6B skp1-ccdc22 1776740 n/a 1776762 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776743 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 6B ccdc22-commd1-4 1776741 n/a 1776744 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776743 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 2A commd1-ccdc22-4 1776742 n/a 1776744 unspecified role unspecified role bait bait n/a 1776743 unspecified role unspecified role prey prey O60826:p.Thr17Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Variant found in a family affected by mental retardation; UniProt FTId: VAR_065912 region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false CCDC22 variants thr30ala, arg128fln, glu239lys, arg321gln also interact physical association physical association false false false 3 E/G